KEGG   Geodermatophilus obscurus: Gobs_4595Help
Entry
Gobs_4595         CDS       T01163                                 

Definition
(GenBank) Ppx/GppA phosphatase
  KO
K01524  exopolyphosphatase / guanosine-5'-triphosphate,3'-diphosphate pyrophosphatase [EC:3.6.1.11 3.6.1.40]
Organism
gob  Geodermatophilus obscurus
Pathway
gob00230  Purine metabolism
gob01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gob00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    Gobs_4595
Enzymes [BR:gob01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.11  exopolyphosphatase
     Gobs_4595
    3.6.1.40  guanosine-5'-triphosphate,3'-diphosphate phosphatase
     Gobs_4595
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ppx-GppA FAM25 Ribosomal_S7
Motif
Other DBs
NCBI-ProteinID: ADB77143
UniProt: D2S4J3
Position
complement(4816561..4817523)
Genome map
AA seq 320 aa AA seqDB search
MQTDRMRLGVLDVGSNTVHLLVVEAHRGGHPTPQHDDRWLLRLAEHVGDDDVLSKDGEKA
LLRAVRKACEQAEKQGCDEVLTLVTSAIREARNGMEVLDRVREKTGVELQVTSGEEEARL
TFLAVRRWFGWSAGRLLVFDIGGGSLELASGLDEDPDVALSLPLGAGRMTRRFLPEARTG
GRPDLRALAELDEHAADLLKPAAKKLLAGGPPDLVAATSKTFRTLARLTGAAPYSAGLRA
PRQLTLDGLGQLLGFVARIESSALAELQGVSPDRAHQIPGGAVVARAAMRALDVPSVRIC
PWALREGVILRRLDSLEDER
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgcagactgaccgcatgaggctcggggtgctggacgtcggctcgaacaccgtgcacctg
ctggtggtcgaggcccatcggggcggccacccgacgccgcagcacgacgaccggtggctg
ctccgcctggccgagcacgtcggcgacgacgacgtcctgtccaaggacggcgagaaggca
ctcctccgggccgtgcgcaaggcctgcgagcaggccgagaagcagggctgcgacgaggtg
ctgaccctggtcacctcggcgatccgcgaggcccgcaacggcatggaggtgctggaccgg
gtgcgggagaagaccggcgtggagctgcaggtgaccagcggcgaggaggaggcgcggctg
accttcctcgccgtccgccggtggttcgggtggagcgccggccggctgctggtgttcgac
atcggcggcgggtcgctggaactggccagcgggctggacgaggaccccgacgtcgcgctg
tcgctcccgttgggcgccggccggatgacccggcgcttcctccccgaggcgcgcaccggc
gggcgccccgacctgcgggcgctcgccgagctcgacgagcacgccgccgacctgctcaag
cccgcggcgaagaagctgctggccggcggaccgccggacctggtggcggcgacgtccaag
acgttccggacgctggcccggctgaccggcgcggcgccctactccgccgggctgcgcgcg
ccgcgccagctgaccctcgacgggctcgggcagctgctcggcttcgtggcccgcatcgag
tcctccgcgctggccgagctgcagggcgtgtcacccgaccgcgcccaccagatccccggg
ggtgccgtcgtggcgcgggccgcgatgcgggcactggacgtaccgtccgtgcggatctgc
ccgtgggcgctgcgggagggcgtcatcctccggcgactggactcgttggaggacgagaga
tga

DBGET integrated database retrieval system