KEGG   Gordonia sp. YC-JH1: CXX93_00830Help
Entry
CXX93_00830       CDS       T05256                                 

Definition
(GenBank) phosphatidylserine decarboxylase family protein
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
goc  Gordonia sp. YC-JH1
Pathway
goc00564  Glycerophospholipid metabolism
goc01100  Metabolic pathways
goc01110  Biosynthesis of secondary metabolites
Module
goc_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:goc00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    CXX93_00830
Enzymes [BR:goc01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     CXX93_00830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase
Motif
Other DBs
NCBI-ProteinID: AUH67178
Position
161704..162420
Genome map
AA seq 238 aa AA seqDB search
MARRPARPDDREGLAHIVDLIRETVPPLHPAGVPFVAAPAALALLGRRHRWIARPAWAAA
GASALFFRHPNRVPPTGDGLVVAPADGTIALVDEAVPLPELGLGDRPVPRVCTFLSVFDV
HVQRVPIAGRVLSVQHTPGKFLSADLPEASSENERTAMTIATGPDGTGPRVGVVQIAGLL
ARRIVCEPAPGEVLSLGDTYGLIRFGSRVDVYLPEGSDVRVALGQRAVGAETVVAELP
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
gtggcccgacgtcccgcccgacccgacgaccgcgaaggcctcgcccacatcgtggacctg
atccgcgaaacggttccaccgctgcatccggcgggcgtgccgttcgtcgccgccccggcc
gccctcgcgctgctgggccgcaggcaccgctggatcgcgcgacctgcgtgggccgccgcg
ggcgcctccgcgctgttcttccggcacccgaaccgtgtgcctccgaccggcgacgggctg
gtggtcgcgcccgccgacggcaccatcgccctcgtcgacgaggccgtgccgctgcccgaa
ctggggctcggcgaccggcccgtaccgcgtgtgtgcaccttcctgtcggtcttcgacgtc
cacgtccagcgggttccgatcgccggccgggtgctgtccgtgcagcacacccccggcaag
ttcctgtccgccgacctcccggaggcgagcagtgagaacgaacgcaccgcgatgaccatc
gccaccggcccagacggaaccggtccgcgagtcggcgtggtgcagatcgccggacttctc
gcccgccgcatcgtctgcgaacccgccccgggcgaggtcctgagtctcggcgacacctac
ggactgatccggttcggctcgcgtgtggacgtctacctccccgagggcagcgacgtccgg
gtcgcactcggccagcgcgcggtcggcgccgagaccgttgtcgcggagctgccctga

DBGET integrated database retrieval system