KEGG   Gordonia sp. YC-JH1: CXX93_10580Help
Entry
CXX93_10580       CDS       T05256                                 

Gene name
sucB
Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 component, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
goc  Gordonia sp. YC-JH1
Pathway
goc00020  Citrate cycle (TCA cycle)
goc00310  Lysine degradation
goc00380  Tryptophan metabolism
goc01100  Metabolic pathways
goc01110  Biosynthesis of secondary metabolites
goc01120  Microbial metabolism in diverse environments
goc01130  Biosynthesis of antibiotics
goc01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    CXX93_10580 (sucB)
  09105 Amino acid metabolism
   00310 Lysine degradation
    CXX93_10580 (sucB)
   00380 Tryptophan metabolism
    CXX93_10580 (sucB)
Enzymes [BR:goc01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     CXX93_10580 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-ProteinID: AUH68720
Position
complement(2265389..2267134)
Genome map
AA seq 581 aa AA seqDB search
MAFSVEMPALGESVTEGTVTQWLKQEGDTVAVDEPLLEVSTDKVDTEIPSPVAGVLVKIV
AAEDDVVEVGGQLALIGEAGESASDDAAAPEPAAAPEPEPEPEPAAPAASAPAAESPATE
APAASTPAASASGVDVLMPELGESVTEGTVTNWLKQVGDTVAVDEPLVEVSTDKVDTEIP
SPTAGVLLEIVADTDEIVEVGGKLAVIGDPSAASAAPAAPAPAPAAAAPAPAAPPTPEPA
APAPEPAPAATAPAPTPAAADGDLQSTPYVTPLVRKLAAENGIDLATVKGTGVGGRIRKQ
DVLAAAEAKKAPAAPAAAPAATPSAPTPAAAPAAASPELAALRGTTQKINRIRQITAAKT
RESLQTSAQLTQVHEVDMTRIAALRTAAKSSFKAAEGVNLTFLPFFAKAVVEALKVHPNV
NASINEEAKEITYHADVHLGIAVDTEQGLLSPVIHNADDLSLAGLARAIADIAARARSGG
LKPDELAGGTFTITNIGSQGALFDTPILVPPQAAMLGTGAIVKRPVVLTGDDGTESIAAR
SMAYLPLTYDHRLIDGADAGRFLTTVRHRLEAAEFAADLGL
NT seq 1746 nt NT seq  +upstreamnt  +downstreamnt
atggccttctctgtcgagatgcccgcactgggcgagagcgtcaccgagggaaccgtcacc
caatggctgaagcaggaaggcgacaccgtagcggtcgacgagcccctgctcgaagtctcc
accgacaaggtcgacaccgagatcccgtcgcccgtcgcgggtgtgctggtcaagatcgtc
gccgctgaggacgacgtcgtcgaggtgggcggacagctggcgctgatcggagaggccggc
gagtcggcgtccgatgacgcggccgcgcccgaacccgccgccgctcccgagccggaaccc
gaacccgagcccgccgcacccgctgcctccgctccggccgccgagagccccgcgaccgag
gcgccggccgcgtcgactcccgcggcctcggcatccggcgtcgacgtcctcatgcccgaa
ctgggcgagagcgtcaccgagggcacggtgaccaactggctcaagcaggtcggcgacacg
gtcgcggtcgacgaaccgctggtcgaggtgtccaccgacaaggtcgacaccgagatcccg
tcgccgacggctggtgtgcttctcgagatcgtcgccgacaccgacgagatcgtcgaggtc
ggcggcaagctggccgtcatcggcgacccgagtgccgcatcggcggcccccgcggctccg
gctcccgctcccgcggctgcggctcccgcgccggccgctcccccgacgcccgagcccgcc
gctccggcacctgaacccgcacccgcggccaccgcacccgctccgactcccgctgccgcc
gacggagatctgcagtccactccgtacgtgacgccgctcgtgcggaagctggccgcggag
aacggaatcgacctggcgaccgtcaagggcaccggcgtcggcggacgcatccgcaagcag
gacgtgctggccgcggccgaggccaagaaggcgcctgccgcccccgccgcggctccggcc
gcaacaccgtcggcgccgacaccggccgccgcacccgccgcggcgagccccgaattggct
gcactgcgcggaacgacgcagaagatcaaccgcatccggcagatcaccgcggccaagacg
cgcgagtcgctgcagaccagcgcgcagctcacgcaggtccacgaggtcgacatgacccgc
atcgcggcactgcgcaccgcggcgaagtcctcgttcaaggcagccgagggcgtcaacctg
accttcctgccgttcttcgccaaggccgtcgtcgaggcactgaaggtgcatccgaacgtc
aacgcctcgatcaacgaagaggccaaggagatcacgtaccacgccgacgtgcatctgggc
atcgccgtcgacaccgagcagggcctcctgtcgccggtgatccacaacgccgacgacctc
tcgctggccggcctcgctcgcgcgatcgccgacatcgccgcacgggcccgttccggcggg
ctcaagcccgacgagctggccggcggcacgttcacgatcacgaacatcggcagccagggc
gctctgttcgacaccccgatcctggtcccgccgcaggcggccatgctcggcaccggcgcg
atcgtcaagcgccccgtggttctcaccggcgacgacggcaccgagtcgatcgccgcacgg
tcgatggcctacctaccgctgacctacgaccaccggctcatcgacggtgcggacgccggc
cggttcctcaccacggtccgtcaccgtctcgaggccgcggagttcgccgccgacctgggg
ctgtaa

DBGET integrated database retrieval system