KEGG   Gemmata obscuriglobus: C1280_04520Help
Entry
C1280_04520       CDS       T05475                                 

Definition
(GenBank) KR domain-containing protein
  KO
K01709  CDP-glucose 4,6-dehydratase [EC:4.2.1.45]
Organism
gog  Gemmata obscuriglobus
Pathway
gog00520  Amino sugar and nucleotide sugar metabolism
gog01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gog00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    C1280_04520
Enzymes [BR:gog01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.45  CDP-glucose 4,6-dehydratase
     C1280_04520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase 3Beta_HSD Polysacc_synt_2 NAD_binding_4 RmlD_sub_bind NAD_binding_10 KR NmrA NEL
Motif
Other DBs
NCBI-ProteinID: AWM36353
UniProt: A0A2Z3GRE7
Position
complement(1072522..1073508)
Genome map
AA seq 328 aa AA seqDB search
MSGFWLDRPTLVTGATGLVGGWVVRRLLRAQADVVCLVRDWAPDSEFERSGLSKQVKSVR
GDVCDQALLERVCGEYEIDTVIHLAAQTLVPVANRNPVATFESNVQGTWALLEACRRSPK
VRQIVLASSDKAYGDAEKLPYDEGTPLQGRHPYDVSKSCADLIAQSYATTYNLPVAITRC
GNFYGPGDLNWNRIVPGTIRSVMRGERPVIRSDGTHIRDYFYVEDGAAAYLMLAEKLAAD
PTLRGEAFNFSNETQVTVLDLVRLLLDQMGTRLTPDVRNEASHEIKHQSLSAAKARARLG
WEPLFTLEEGLSRTVPWYRNFLGARKAA
NT seq 987 nt NT seq  +upstreamnt  +downstreamnt
atgagcgggttctggctcgatcgaccgacgctcgtcaccggcgccacggggttggtgggc
gggtgggtcgttcgccggctcctgcgcgcgcaggcggacgtggtgtgcctggtccgcgac
tgggcgccggacagcgagttcgagcgcagcgggctctcgaagcaggtgaagtccgtccgc
ggggacgtgtgcgaccaggcgctgctcgagcgggtgtgcggcgagtacgagatcgacacc
gtcatccacctcgcggcgcaaacgctggtgccggtggcgaaccgcaacccggtcgccacc
ttcgagagcaacgtccagggcacctgggcgctgctggaggcgtgccgccgcagcccgaag
gtgcggcagatcgtcctcgcctcctccgacaaggcctacggcgacgccgagaagctgccc
tacgacgagggcaccccgctccagggccgccacccctacgacgtgagcaagtcctgcgcg
gacctgatcgcgcagagctacgccaccacctacaacctgcccgtcgcgatcacccggtgc
ggcaacttctacggcccgggcgacctgaactggaaccggatcgtccccggcaccatccgc
tcggtgatgcgcggcgagcggccggtgatccggtccgacgggacgcacatccgcgactac
ttctacgtcgaggacggggccgcggcgtacctgatgctcgcggagaagctggccgccgac
ccgaccctccggggcgaggcgttcaacttctcgaacgagacccaggtgaccgtgctggac
ctcgtgcgactgctgctcgaccagatggggacgcgcctcacgcccgacgtgcggaacgag
gcgagccacgagatcaagcaccagtcgctcagcgccgcgaaggcccgcgcccggctcggc
tgggagccgctgttcaccctcgaagaggggctgagccggacggtgccctggtaccgcaac
ttcctgggagcgagaaaagccgcatga

DBGET integrated database retrieval system