KEGG   Gemmata obscuriglobus: C1280_12745Help
Entry
C1280_12745       CDS       T05475                                 

Definition
(GenBank) nucleoside-diphosphate sugar epimerase
  KO
K01784  UDP-glucose 4-epimerase [EC:5.1.3.2]
Organism
gog  Gemmata obscuriglobus
Pathway
gog00052  Galactose metabolism
gog00520  Amino sugar and nucleotide sugar metabolism
gog01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gog00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    C1280_12745
   00520 Amino sugar and nucleotide sugar metabolism
    C1280_12745
Enzymes [BR:gog01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.2  UDP-glucose 4-epimerase
     C1280_12745
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd 3Beta_HSD NAD_binding_10 RmlD_sub_bind Polysacc_synt_2 NAD_binding_4 NmrA adh_short NAD_binding_2
Motif
Other DBs
NCBI-ProteinID: AWM37778
UniProt: A0A2Z3GWR6
Position
3051981..3052943
Genome map
AA seq 320 aa AA seqDB search
MNYFVTGGAGFIGSNLVDRLLAAGHHVTAFDNFSTGQRPFLADALKSDRFALVEGDLLDK
PVLTRAVAGHDFVFHLAANADVRFGTNHPDRDLQQNTIATFNVLEAMRLNGVKRIGFSST
GSVYGEANVFPTPEDAPFPIQTSLYAASKVAGEGLLSAYATGFGFQAFIFRFVSILGERY
THGHVFDFYAKLLANPNQIEVLGNGKQRKSYLYVQDCVDAIFTVVEKATEPVNVVNLGAD
EYCQVDDSLGWICDRLGLRPQVNHTGGARGWIGDSPFIFLDTAKLKSFGWRQKLGIREAV
GRTLDYLRANPWVLESRKAA
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
gtgaactattttgttaccggcggggccgggtttatcggcagcaacttggtggaccggctg
ctcgcggccggccaccacgtcaccgcgttcgacaacttcagcaccggacagcggccgttc
ctggcggacgcgctcaagagcgaccgcttcgcgctcgtggaaggcgatctgctcgacaaa
ccggtgctgacccgcgccgtcgccggacacgacttcgtgttccacctggcggccaacgcg
gacgtccggttcggcaccaaccaccccgaccgcgatctgcaacagaacaccatcgcgacg
ttcaacgtgctcgaagcgatgcgcctgaacggcgtgaaacgcatcggcttttcgtccacc
gggtcggtgtacggcgaagccaacgtgttccccacccccgaggacgcgccgttcccgatc
cagaccagcctgtacgcggccagcaaggtcgcgggcgaagggctcctctccgcttacgcg
accgggttcgggtttcaggcgttcatcttccgcttcgtgtcgatcctgggcgagcggtat
acacacggtcacgtgttcgacttctacgccaaactgctcgccaacccgaaccagatcgag
gtgctcgggaacgggaagcagcgcaagagctacctgtacgttcaggactgcgtcgacgcc
attttcacagtggttgagaaggcgaccgagccggtcaacgtggtgaacttgggcgcggac
gagtactgccaggtcgacgactcgctcggttggatctgcgaccggttgggactgcggccc
caggtgaaccacaccggtggcgcacgcggctggatcggcgacagcccgtttatcttcctc
gataccgccaaactgaaatcgttcggctggcgccagaagctgggcatccgcgaggcggtc
ggccgcacgctcgattacctgcgggcgaacccgtgggtgctggagtcgcgcaaagctgct
tag

DBGET integrated database retrieval system