KEGG   Gemmata obscuriglobus: C1280_16115Help
Entry
C1280_16115       CDS       T05475                                 

Definition
(GenBank) mannose-1-phosphate guanylyltransferase
  KO
K00971  mannose-1-phosphate guanylyltransferase [EC:2.7.7.13]
Organism
gog  Gemmata obscuriglobus
Pathway
gog00051  Fructose and mannose metabolism
gog00520  Amino sugar and nucleotide sugar metabolism
gog01100  Metabolic pathways
gog01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gog00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    C1280_16115
   00520 Amino sugar and nucleotide sugar metabolism
    C1280_16115
Enzymes [BR:gog01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.13  mannose-1-phosphate guanylyltransferase
     C1280_16115
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: NTP_transferase NTP_transf_3 MannoseP_isomer
Motif
Other DBs
NCBI-ProteinID: AWM38364
UniProt: A0A2Z3H9K8
Position
complement(3901910..3902998)
Genome map
AA seq 362 aa AA seqDB search
MLHAMIMAGGGGTRFWPRSRSKRPKQFLTFSGNRTLLQSTVDRVSAQIPPERTWVVTGAQ
YADETAAQLPELPRDHIIGEPEGRDTAPCVGLGAAIIAKADPNATIAVMPADHVIEPEQE
FRRALHAAEQFLADEPNKLITFGIRPTFPSTGYGYIKRGAAAGTRQGVTASQVEVFREKP
EFSVAEQYVASGEYDWNSGIFVWKPGAILGELKARKPDIHAVVAKIAEAWGAPEFDAVFR
GTYNQAEKKSIDYAVMQDAAKEGKVLVLAAPYTWDDVGSWLALERRNPQDANHNTVQANH
CGIDTNKCVIVGEPKTVIATYGVSNLLVIQDGDAILVADRKHEDKVKEIVDALKKSNRGE
FT
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacgcgatgattatggccggcggcggcggcacccggttctggccccggagccgg
tccaagcggcccaagcagttcctcacgttcagcggtaaccgcaccctgctgcaaagcacg
gtcgatcgcgtgtcggcccagatcccgccggagcgcacttgggtcgtcaccggcgcccag
tacgccgacgagaccgcggcccaactgccggaactgccgcgcgaccacatcatcggcgag
ccggagggccgcgacacggccccgtgcgtcgggctcggcgccgcaatcatcgcgaaggcc
gacccgaacgccacaatcgcggtgatgccggccgaccacgtcatcgagccggagcaggag
ttccggcgcgcgctccacgccgcggagcagttcctggccgacgagccgaacaaactcatc
acgttcggcatccgcccgacgttcccgtccaccgggtacgggtacatcaagcgcggagcg
gcggcgggtacgcgccagggcgtgaccgcgtcgcaggtagaggtgttccgcgagaagccc
gagttctcggtcgcagaacagtacgtcgcgagcggcgagtacgactggaacagcggcatc
ttcgtctggaagccgggcgccatcctcggtgaattgaaggcccgtaagcccgacattcac
gcggtcgtcgccaagatcgcggaggcgtggggtgcgcccgagttcgacgcggtgttccgc
ggcacgtacaaccaggccgaaaagaagagcatcgactacgccgtgatgcaggacgcggcc
aaagagggcaaggtgctggtcctcgccgcgccctacacgtgggacgacgtggggagttgg
ctggcgctggagcggcgcaacccgcaggacgcgaaccacaacacggttcaggctaaccat
tgtggcatcgacacgaacaagtgtgtcatcgtcggagagccgaagacggttattgcgacc
tacggcgtgagcaacctgctggtgatccaggacggcgacgcgatcttggtcgcggaccgg
aagcacgaggacaaggtgaaagagatcgtggacgcgctcaagaagagcaaccgcggggag
ttcacgtga

DBGET integrated database retrieval system