KEGG   Gluconobacter oxydans H24: B932_0131Help
Entry
B932_0131         CDS       T02348                                 

Definition
(GenBank) glutathione synthetase
  KO
K01920  glutathione synthase [EC:6.3.2.3]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00270  Cysteine and methionine metabolism
goh00480  Glutathione metabolism
goh01100  Metabolic pathways
Module
goh_M00118  Glutathione biosynthesis, glutamate => glutathione
Brite
KEGG Orthology (KO) [BR:goh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    B932_0131
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    B932_0131
Enzymes [BR:goh01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.3  glutathione synthase
     B932_0131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSH-S_ATP GSH-S_N RimK ATPgrasp_YheCD ATPgrasp_ST GSP_synth
Motif
Other DBs
NCBI-ProteinID: AFV99741
UniProt: K7SSA1
Position
complement(131746..132723)
Genome map
AA seq 325 aa AA seqDB search
MSRSLRVAVQMDPLEQVNIDGDSTFALMLEAQARGHELWVYPVSTLSLTEGQGKDGRLQA
RARRVEVRRVRGDHATFGEEEILPLGETDVILMRQDPPFDMGYITATHMLEHVHGVGEGL
SLVVNDPVAVRNAPEKLLVTHFPHLMPPTLVAWDPRDILAFREKHQDIIVKPLYGNGGAG
IFRIKPDDENLKALLEMHFARTNEPLMIQRYEPAVRKGDKRIILVDGQPIGAINRVPATG
EARSNMHVGGRAERVDLTDRDKEICESIGPYLRDHGLIFTGIDVIGDWLTEINVTSPTGL
QELDRFEGINSAGLIWDAIERRYAP
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctcactccgggttgccgtacagatggacccgctagaacaggtcaacatcgac
ggcgactccacttttgccctcatgcttgaagcgcaggcgcgtggacacgagctctgggtt
tatcctgtttcgacgcttagcctgacggaagggcagggcaaagacggccgtcttcaggcc
cgtgcccgccgggtggaggtccgtcgcgttcgcggcgatcatgcgacttttggggaagaa
gaaatccttccgctgggcgagacggacgttatcctgatgcgtcaggaccctccgttcgac
atgggctacatcactgccacgcacatgctggagcatgttcatggcgttggtgagggactg
tcactggtggtgaacgatccggtagcggttcggaacgcaccagagaagctgctggttacg
catttcccgcatctgatgccgccaacgctggtggcatgggatccacgggacattctcgcc
ttccgtgagaagcatcaggacatcatcgtcaagccgctttacgggaatggcggtgcgggc
attttccgcatcaagccggatgatgaaaacctgaaggccctgctggaaatgcattttgcg
cgtaccaatgagcctttgatgatccagcgttacgagcctgctgttcgtaaaggtgacaaa
cgcatcatcctggtggacggacagccgatcggtgccatcaatcgtgttccggcaacgggt
gaggcgcgttcgaacatgcatgttggcggacgtgccgagcgcgtggacctgacggaccgt
gacaaggaaatctgtgagtcgattggtccctatctgcgcgaccatgggctgattttcacg
gggatcgacgtgattggtgactggctgacggaaatcaacgtcacgtctccaaccggcttg
caggaactggatcgttttgaaggcatcaacagtgccggtctgatctgggacgccattgag
cggcgttacgcgccctga

DBGET integrated database retrieval system