KEGG   Gluconobacter oxydans H24: B932_0174Help
Entry
B932_0174         CDS       T02348                                 

Definition
(GenBank) glycyl-tRNA synthetase subunit alpha
  KO
K01878  glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:goh00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    B932_0174
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:goh01007]
    B932_0174
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:goh03016]
    B932_0174
Enzymes [BR:goh01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.14  glycine---tRNA ligase
     B932_0174
Amino acid related enzymes [BR:goh01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   B932_0174
Transfer RNA biogenesis [BR:goh03016]
 Prokaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    B932_0174
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_2e N-glycanase_C
Motif
Other DBs
NCBI-ProteinID: AFV99784
UniProt: K7T5R5
Position
174957..175835
Genome map
AA seq 292 aa AA seqDB search
MSATRPLSFQDLILRLHQFWSEKGCAILQPYDTEVGAGTLSPHTTLRALGSKPWAAAYVQ
PCRRPSDGRYGENPNRLQQHHQYQVLLKPTPEESQNLLLESYRAVGIDPEKHDIRFVEDD
WENPTIGAWGLGWEVWCDGMEVTQFTYFQQVGGIPTVMPSTELTYGLERLAMYVQDVENV
YDLDYNGKGLTYGDVFLRAERDYSRHNFELADTQLLLTHFNNVEKESIRLAEAGVAQPAF
DQCLKASHYFNLLDARGVISVSERASYIGRVRTLAKASCEAWLAGEEETSNG
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
ttgtctgcgacccggccgctcagctttcaggacctgatcctgcgccttcatcaattctgg
tctgaaaagggctgcgctatcctgcagccctatgacacagaagtcggagccggaacgctc
tcccctcatacgaccctgcgcgccctgggctcaaagccatgggctgcggcctatgtgcag
ccctgccggcgcccgtccgacggtcgttacggtgagaacccgaaccgcctccagcagcat
caccaatatcaggtgctgctgaagccaacaccagaagagagccagaacctgctcctggaa
agctatcgcgccgtgggtatcgaccctgaaaagcacgatatccgattcgtggaagacgac
tgggaaaacccgacgatcggcgcctggggtctgggttgggaagtctggtgtgacggcatg
gaagtcacgcagttcacgtatttccagcaagttggcggtatcccgaccgtcatgccttcc
accgaactgacctatggtctggaacggttggccatgtacgtgcaggatgtcgagaacgtc
tatgaccttgattataatggtaaaggtttgacttatggggacgttttcctgcgcgcagaa
cgcgattactcccgacataattttgaattggccgacacacagcttctgctgacgcatttt
aataatgtggaaaaagagtccatccgtctggcagaagctggcgtcgcacagcctgcgttc
gatcagtgcctgaaggcttcccattatttcaatcttctggatgcccgcggcgtgatttcc
gtctctgaacgcgcatcctatatcggacgcgtccggacgctggcgaaagcctcctgtgaa
gcgtggctcgctggcgaggaggagacgtccaatggctga

DBGET integrated database retrieval system