KEGG   Gluconobacter oxydans H24: B932_1356Help
Entry
B932_1356         CDS       T02348                                 

Definition
(GenBank) Delta 1-pyrroline-5-carboxylate dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00250  Alanine, aspartate and glutamate metabolism
goh00330  Arginine and proline metabolism
goh01100  Metabolic pathways
goh01110  Biosynthesis of secondary metabolites
goh01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:goh00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    B932_1356
   00330 Arginine and proline metabolism
    B932_1356
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:goh03000]
    B932_1356
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     B932_1356
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     B932_1356
Transcription factors [BR:goh03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    B932_1356
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh Pro_dh-DNA_bdg PRODH
Motif
Other DBs
NCBI-ProteinID: AFW00938
UniProt: K7SL66
Position
complement(1372594..1376250)
Genome map
AA seq 1218 aa AA seqDB search
MTHPTTNPASRPAAPFAELLLSRAPRSAHRDCISTAHYRSEADCMNDLLPVATLTTEQDQ
RANRIAHLVAQTVREAPPNAIESLIKTFPLSAPEGQAVLCLAEALLRIPDSSTQDALIRS
LVGHADWGRHISKRQSSLINSIALNLSLASRLNQSKGFSLRRLTLQTSVPMIRRGLEKSV
RTLGTSFILGSTLGMALRASAAGEKLGLTYAYDLQVNTALTAEQALNALTAYEDALEDIS
QHAGITGNFHERPILCVRLPALSARFGRFRRERIMTELLPTLQRLAIRARHLDVGLLFST
EDSTHLETALDLLEALCILPELGSWNGLGLTVQTYDRRASAVVAFLIDLGRRTGRRILVR
LVKGACWDSEIRQAQKSGLADFPVFTRRCHTDVSYIACARQLLEALDASYPQFATHNPRT
IGHILALADKPEPGDFEFACLQGLGLPLAQFLRDKQGLNLPCRIHAPVGESQALMPGLVR
QLMENGPGSLGLRRNADPAATIEALTADPVVATRLIPPTERASRSVRTPSDLFLPGRRNA
TGVDLFSEETLRALYAVLEGDAPFLHAAPITPGIDISTSRSRMIYNPADRHDPVGDVVET
DGQTLLAALQSAEQALPAWSASKPEDRITALVKAAELIETHQIELMALLVREAGKTLPAA
QDEVREAVSILRHDAERLQGRDYHLHAAPLGLVACISPWSSPLAAFVQQISVSLAAGNVV
LAKPAEQTPFIASRAVQILHEAGIPQNALHLLPGNGSVGERLTTDHRINAVMFTGSTPIG
KAVSRQIFDRQGRTGTPVPIVTRTGGQNAMLVDSSAQPEQVVQDILTSAFDSAGQRCSSL
RILLLQEECAEEILHLLKGALQDLAIGNPARLSTDIGPIISAEARTEALDHIELMRRAGR
TIWSPELGENCRYGHFLPPTLIEIGRVADIPHEVFGPILHVRRFSRNEADGVIDAVNSMG
YGLTFGVHSRIPATVERATRRIQAGNIYVNRAITGAVIGSQPFGGSGLSGCGPKVGGPFA
LRRMSTQSGPWFPPQDATPGQIPRHAHSLVTFLESRDAVSARQIRQDIAHVMTGFSMALP
GASGETNTLTLTPCGPVLCAGESWPAILRAVGMALGTGNPALVLGPDHALDWMHRLPQGL
TDRIQRVDPGALPECAAMIMERHSTRALQAASTLTAREGRIIPIYMLDCLRPEWLLEERV
VTVNTAALCGDPTMMALS
NT seq 3657 nt NT seq  +upstreamnt  +downstreamnt
atgacccatccgacgacaaacccggcttcacgccctgctgctcctttcgcagaacttttg
ctgtcacgcgcgccacgttctgcccatcgggattgcatttccaccgcacattaccgctct
gaagcagactgcatgaacgacctgctgccagttgccactctgacaaccgaacaggatcag
cgagccaaccggattgcgcatctcgtcgcccagactgttcgtgaagcacccccgaacgcg
atcgaaagtctgataaagactttccctctgtccgcgccggaaggtcaggccgtcctgtgt
ctggcggaagctcttctgcgcattccggattccagtacgcaggacgccctgatccggtcc
cttgtggggcacgcggactgggggcgccatatcagcaagcgacagtcttcccttataaat
tccattgctctgaacctttcgctcgcgtcgcgtctcaaccagagcaaaggcttcagcctc
cggcgtctgacgctccagacttcggtgcccatgatccgtcgtggactggaaaaatccgtc
cgcactcttgggaccagcttcattctgggctccacactggggatggcgctccgggcgtct
gcggctggcgaaaagctgggcctgacctatgcctatgatctccaggtcaataccgctctg
acggccgagcaggctttgaacgctctgacagcttatgaagatgcgctggaagacatcagc
cagcacgctggcatcacaggtaatttccacgagcgcccgatcctctgcgtgcgtctgcct
gccctgtcggcccgtttcgggcggttccgccgtgaacgcatcatgacagaactgcttcca
acattgcagcgattggccatccgggcacgccatctggatgttggtctcctgttttccacc
gaagacagtacccaccttgaaaccgctctggatctgctggaagcgctctgtattcttccc
gaactgggaagctggaacggccttgggctgaccgttcagacttacgaccgtcgcgcctct
gctgtagtggcattcctgattgatctggggcgccgcaccgggcgccgcattcttgtcagg
ctggtcaaaggggcttgctgggattcggaaattcggcaggcacagaaaagtggtctggca
gattttcccgtttttacccgtcgatgccacacggatgtcagctatatcgcctgcgcccga
cagcttctggaagcgctggacgcgagttacccacagtttgccacccataatcctcgtaca
attggccatattctggcccttgccgacaaaccagaaccgggggatttcgaattcgcctgt
cttcagggtctcggattgcctctggcccagtttcttcgtgataaacagggcttgaattta
ccctgtcgcatccatgccccggttggggaatcccaggctcttatgccggggctggtccgt
cagttgatggagaatggtccgggctctctgggtctgcgtcgcaatgcagatcccgccgcc
acaatcgaagcactcacagctgatccggttgtggcaacacgcctgattccccccacagaa
cgcgcgagccgttccgtacggaccccttcagatctgttcctgccgggacgacgaaatgcg
acgggtgttgatctgttcagcgaagagactttacgagcgctttatgcggtcctggaggga
gacgcgcccttcctgcatgcggctcccataacgcccggtattgatatcagcaccagtcgt
tcccgcatgatctataatcctgctgatcgacatgatcctgtaggggatgtggtcgaaacg
gatgggcagacccttcttgctgctctgcaatccgcagaacaggcccttcctgcgtggtca
gcgagcaaacctgaagaccgtattacagcactggtcaaagccgcagagctgattgagacg
catcagatcgagctaatggccctccttgtgcgggaagctggcaagacacttccagccgca
caggatgaagtccgagaggccgtcagcattctgcggcatgatgcagaacggcttcagggc
cgggattaccatcttcatgcggcacccttgggtctggtcgcctgtatcagtccgtggagc
agccctctggcggctttcgttcagcagatctccgtttcccttgcggcgggaaatgttgtt
ctcgccaagccagcggaacagacgccatttattgcaagccgggccgtccagattctgcat
gaggcgggtattccccaaaacgctctgcatctgctgcccggcaacgggtccgtaggggaa
cgccttacgacggatcaccgcattaatgctgtgatgttcaccggctcaacgcccatcggg
aaagccgtctcccggcagatttttgaccgtcagggtcgaactggcacccccgttccaatc
gtgacacgcacaggcggccagaatgcgatgctggtggacagctctgcccagccggaacag
gttgtgcaggatattctgacctcagccttcgacagtgcgggccagcgctgctcctcgctg
cgcatcctgctgcttcaggaagagtgtgctgaggaaattcttcaccttctgaaaggcgcc
cttcaggatctggcgatcggcaatcccgcgcgcctgtccacggatatcggcccaatcatt
tctgcagaagcccggactgaggcactggatcatattgaactgatgcgccgcgccgggcgg
accatctggtctcccgaactcggagagaactgccgttacggtcatttcctccccccgacc
cttattgaaatcgggcgtgtggccgatatcccgcatgaagtattcggccccattctccat
gtgcgccgcttcagccgcaacgaagcggatggcgttatcgatgctgtgaactccatggga
tatggcctgacttttggcgttcattcccgcatcccggctaccgtcgaacgtgcgacacgt
cgcattcaggcagggaacatctacgtcaaccgtgctatcacgggtgcggtcatcggctcg
cagccttttggtggctccggcctgtcaggctgtggcccgaaagtgggtggaccgtttgcc
ctgcgtcgcatgagtacacagagcgggccctggttccctccgcaagacgccacacccggc
cagatcccacgtcatgcgcacagtcttgtcacgtttcttgagagccgggatgccgtttca
gcacgacagatccgtcaggatattgcacatgtcatgaccggattttccatggcccttccc
ggagcttccggcgaaaccaacacgctgacactcacaccgtgcggtccggttctgtgtgca
ggcgaaagctggcctgccattctgagggccgtaggcatggccttgggaaccgggaaccct
gcgctcgttcttggccctgaccacgctctggactggatgcatcgtctgccgcagggactg
actgaccgtatccagcgtgttgacccgggagccttgccggaatgtgcggccatgatcatg
gagcgtcactcaacgcgtgccttacaggccgcctcaacgctgacagcccgtgaggggcgg
atcattcccatttatatgctggattgcctgcgccctgaatggctgctggaagagcgcgtt
gtcacggtcaatacggctgctctctgtggcgatccgaccatgatggcgctctcctga

DBGET integrated database retrieval system