KEGG   Gluconobacter oxydans H24: B932_1479Help
Entry
B932_1479         CDS       T02348                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00780  Biotin metabolism
goh01100  Metabolic pathways
Module
goh_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:goh00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    B932_1479
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:goh01007]
    B932_1479
Enzymes [BR:goh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     B932_1479
Amino acid related enzymes [BR:goh01007]
 Aminotransferase (transaminase)
  Class II
   B932_1479
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP SHMT Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AFW01058
UniProt: K7SLM0
Position
complement(1493608..1494786)
Genome map
AA seq 392 aa AA seqDB search
MTLFDAHFAAALQKRDAVGTRRVLRPVTRETGAILRDGQRLIDVSSNDYLGLADHPLLRE
RAADWALRYGTGARASRLVSGTLDLHQAVEEKLARFKHCDAALLFASGWQANASVVPALC
ALSVAQTGHPMIVFSDRLNHASLHHGCAAAGVRQVRFRHNDLAHLETLLKREAATPGLRM
IVTESVFSMDGDRADIPALRSLADRYDAFLYVDEAHATGVLGPQGCGLSGGLADLTMGTC
SKALGGMGAYIAGSRLLCDYLINHASGFIYSTALPPAVLGAIDAALDVIPDMDTERKTLL
GQAGTLRTILNSAGFDTAESTTQIVPVLIGEAQRALDVATALEGEGFLTVAIRPPTVPAG
TARLRIALHVGLQDADVERLAAAIIRLVGKEQ
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgaccctgtttgacgcccatttcgctgcggctcttcagaaacgtgatgcggtcggtacc
cgccgggttctacgacccgtcacccgcgagacaggagcaatcctgcgcgatggacagcgt
ctgattgacgtttcctccaacgattatctgggccttgcggatcatcccctgttgcgggaa
cgggcagcagactgggcccttcgatatggaaccggagcgcgggcatcccggctggtgagt
ggcacgttggatctgcatcaggctgtcgaagaaaaactggcccggttcaagcactgtgac
gcagcgctcctgtttgcctcaggctggcaggcaaatgcctccgtcgtcccggcactctgc
gccctttcggtggcccagaccggccatccgatgattgttttttcggaccgtttgaatcat
gccagtcttcatcatggatgcgcagccgcaggcgttcggcaggtccggttccgtcacaac
gaccttgcccatctggaaacactcctgaagcgcgaagctgccacgcccggcctgcgaatg
atcgtgacggaaagcgtgttctccatggacggagaccgcgcggacatcccggcccttcgg
tcgctggcagaccgttatgacgcgtttctgtatgttgacgaagcgcatgccactggcgtt
ctggggcctcaggggtgtggtctttccggcggtctggctgatctgaccatgggcacatgc
agcaaggcgctcggcggaatgggtgcttacatcgccggttcccggctgctctgcgactat
ctcatcaatcacgcttctggattcatctacagtacggcccttcctccagcggttctcggg
gccatagatgccgccctggacgtcattcctgatatggacacggagcggaaaaccctgctg
gggcaggctgggacgttgcggaccatcctgaacagcgccgggttcgataccgccgaatcc
acgacgcagatcgtccctgttctgataggggaggctcaacgtgcactggatgttgcgaca
gctctggagggcgaagggttcctgaccgtggcaatccgccctcccactgttccggctgga
acggcgcggttgcggattgccctgcatgtcggtctccaggatgccgacgtcgagcgtttg
gccgccgccatcattcgactggtgggcaaggagcaatga

DBGET integrated database retrieval system