KEGG   Gluconobacter oxydans H24: B932_2707Help
Entry
B932_2707         CDS       T02348                                 

Definition
(GenBank) dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00010  Glycolysis / Gluconeogenesis
goh00020  Citrate cycle (TCA cycle)
goh00620  Pyruvate metabolism
goh01100  Metabolic pathways
goh01110  Biosynthesis of secondary metabolites
goh01120  Microbial metabolism in diverse environments
goh01130  Biosynthesis of antibiotics
goh01200  Carbon metabolism
Module
goh_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:goh00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    B932_2707
   00020 Citrate cycle (TCA cycle)
    B932_2707
   00620 Pyruvate metabolism
    B932_2707
Enzymes [BR:goh01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     B932_2707
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 HlyD_3 Ribosom_S12_S23
Motif
Other DBs
NCBI-ProteinID: AFW02255
UniProt: K7TC18
Position
complement(2705357..2706589)
Genome map
AA seq 410 aa AA seqDB search
MATDILMPALSPTMTEGKLARWLKNEGDTVSAGDVIAEIETDKATMEVEAVDEGILGRIL
VQEGAEGVAVNTPIAILVEEGEEVPVASSGQTSAIAASAAEPVAAASAPAPSAKAASKEE
SSERIFVSPLAKRMAKERGIALGSLNGTGPNGRILKRDVEKGGNAAPAAPKAAPVTPVAV
EGDVKRVPNSTMRKVIARRLTESKTQVPHFYVSVDIELDALLALRSKLNATAEENNFKLS
VNDMMIKAVGLALKKVPGLNVQFTDSETLHFENVDISMAVSIPDGLITPIIRNADQKSLR
EISREAKDLAKRARAGKLKPEEFQGGTFSISNMGMFGVRDFAAIINPPQAGILAIASGEK
RAVVRGDQLAIATVMTATLSVDHRAVDGALGAQWLNALRDIVQNPYTLVV
NT seq 1233 nt NT seq  +upstreamnt  +downstreamnt
atggcaaccgatatcctgatgccggctctgtcgccgacaatgaccgagggcaaactggcc
cgctggctcaaaaatgaaggcgatacagtttcagccggtgatgtgatcgccgaaatcgag
accgacaaggccacaatggaagtcgaagctgtggacgagggcatactcggccgcattctt
gttcaggaaggcgcagaaggcgttgcggttaacacgccaatcgccatccttgtagaggaa
ggcgaagaggtgccagtagcgtcttccgggcagacgtctgctatcgcggcttcggccgct
gagcctgttgctgctgcaagtgcacctgcgccaagcgccaaagccgcctcgaaagaggag
agcagtgagcgtatttttgtctcgccgctggcaaagcgtatggccaaagagcggggcatc
gctcttggctctctgaacggaacaggcccgaatggccgtattctgaaacgggacgttgag
aagggcggtaacgctgctccagccgcaccgaaagctgcacctgtaacgccggttgccgtt
gaaggtgacgtaaagcgcgttccgaattccacgatgcgcaaggtcattgcgcggcgtttg
acggaatcgaagacgcaggttccgcatttctatgtctcagtggacatcgaacttgatgct
ctgctcgcacttcgctcaaagctgaatgcgaccgccgaggagaacaacttcaagctctcg
gtcaatgacatgatgatcaaggctgtcgggctggcactgaaaaaggtaccgggtctgaac
gttcagttcacggattccgagacgctgcatttcgagaatgtggacatctcaatggctgta
tccatcccggatggcctgatcacgccgatcatccggaatgcggaccagaagtccctgcgc
gaaatcagccgtgaagccaaggatctggccaagcgtgcacgtgcgggcaagctgaagccg
gaagaattccagggcggtacgttctccatttcgaatatgggaatgtttggcgtccgggat
tttgccgcgatcatcaatccgccgcaggccggaattctggccattgcgtccggagagaaa
cgtgccgtggttcggggagaccagcttgcaattgcaactgtcatgaccgcgacactttct
gttgatcatcgtgccgttgatggcgcacttggggcacagtggctgaatgccctgcgcgat
atcgtacagaacccttacactctggtggtctga

DBGET integrated database retrieval system