KEGG   Gluconobacter oxydans H24: B932_3505Help
Entry
B932_3505         CDS       T02348                                 

Definition
(GenBank) NAD(P)-dependent glucose 1-dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
goh  Gluconobacter oxydans H24
Pathway
goh00030  Pentose phosphate pathway
goh01100  Metabolic pathways
goh01120  Microbial metabolism in diverse environments
goh01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goh00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    B932_3505
Enzymes [BR:goh01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     B932_3505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C Polysacc_synt_2 Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AFW03044
UniProt: K7SI18
Position
3559343..3560143
Genome map
AA seq 266 aa AA seqDB search
MAAPYSNRFAGKKVLVTGASQGIGEATALRFAEEGAQVALNGRKEDKLIAVRDKLPKVSG
GEHPIATGDISKEEDVRRLMRESIEAMGGLDVLVCNAGYQIQSPSEDIKLEDFEGVMAVN
VTGVILPCREAIKYWLENGIQGAIVVNSSVHQIIPKPHYLGYSASKGAVGNIVRTLALEY
ASRGIRVNAVAPGAIVTPINMSWVNDPVQYKNVSDHIPMKRPGEGREIADAVTFLAAEDS
TYITGQTLYVDGGLTLYGDFEKNWSS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atggccgccccttacagcaatcgtttcgccggcaagaaagtactcgttacgggtgcatcc
cagggtattggtgaggccacagccctccgctttgcagaagaaggcgctcaggtcgcactg
aatggccgcaaggaagacaagctgattgctgtccgcgataagcttccgaaggtttctggc
ggtgaacatccgatcgccacaggtgacatctccaaggaagaggacgtccgccgcctgatg
cgcgaaagcatcgaggccatgggtggactggatgttctggtctgcaacgcaggttaccag
atccagtctccgtccgaggacatcaagctggaagacttcgaaggcgtgatggccgtcaat
gtcactggcgtgatattgccatgtcgcgaagccatcaagtactggcttgaaaacggcatt
cagggagcgatcgtcgtgaattcctctgttcaccagatcatcccgaagcctcactatctc
ggctactctgcttccaaaggcgccgtaggtaacatcgtccgcacgctggctctggaatac
gcaagccgtggcatccgtgtgaacgcggtcgcaccgggtgccatcgtgacgccaatcaac
atgtcctgggtcaatgatcccgtacagtacaagaacgtgtctgatcacattccgatgaag
cgcccaggcgaaggccgggaaattgctgatgccgtcacgtttcttgcggcggaagacagc
acctacatcacaggtcaaaccctctatgtggatggcggcctgacgttgtatggtgacttc
gaaaagaactggtcctcgtaa

DBGET integrated database retrieval system