KEGG   Gordonia sp. MMS17-SY073: D7316_01282Help
Entry
D7316_01282       CDS       T05722                                 

Gene name
nat
Definition
(GenBank) Arylamine N-acetyltransferase
  KO
K00622  arylamine N-acetyltransferase [EC:2.3.1.5]
Organism
gom  Gordonia sp. MMS17-SY073
Pathway
gom01100  Metabolic pathways
gom01110  Biosynthesis of secondary metabolites
gom01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gom00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00232 Caffeine metabolism
    D7316_01282 (nat)
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    D7316_01282 (nat)
Enzymes [BR:gom01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.5  arylamine N-acetyltransferase
     D7316_01282 (nat)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetyltransf_2
Motif
Other DBs
NCBI-ProteinID: AZG44696
UniProt: A0A3G8JHX7
Position
1373875..1374714
Genome map
AA seq 279 aa AA seqDB search
MSTTTGFDVDAYFQRIGYSGAVAPTLDTLTALVAAHVRHIPFENLDPLTGTPVDRLDPES
LQDKLVRRRRGGFCYEQNGLFRYALRALGYGVEPLAGRVVWMRPPGPLPAETHQLLSVAV
PDEPGRLLVDVGFGGQTPTAPLHFTIGEEQPTDLEPFRIVATDDERLLRMESRIGGEWRP
LYLFSPNPRPEIDSVVGSWFASTHTGSHFRSRLTACAIVGDARWNLGGRTLTIHSAQGAT
DKRRLADADEVLDLLAGGFGIDLTGIEGLGDRVGEVLDN
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgagcacaaccaccgggttcgacgtcgacgcgtacttccagcgcatcgggtactcgggt
gcggtggcgccgacgctcgacaccctcaccgcactcgtcgccgcgcatgtacgccacatc
ccgttcgagaacctggaccccctgacgggcacgccggtcgaccgactcgatccggagagc
ttgcaggacaagcttgttcgccgccgaagaggcggattctgctatgaacagaacggcctg
ttccgatacgccctccgcgcactcggctatggcgtcgagccactcgccggtcgtgtcgtc
tggatgaggccaccgggcccgttgcccgccgagacccatcaactgctgtccgtcgcggtc
cccgacgagcccggcagactgctcgtcgatgtgggcttcggcggccagacacccaccgcc
ccgctgcatttcaccatcggcgaggaacagccgacagacctcgagccgttccgtatcgtc
gcgaccgacgacgaacggttgctgcggatggagtcccggatcggcggcgaatggcgtccg
ctctatctgttcagcccgaacccgcgaccggagatcgacagtgtggtcggcagctggttc
gcatccacacacaccggatcgcatttccgcagtcgcctgacggcatgcgcgatcgtcggc
gacgcccggtggaacctgggcggccgcactctcaccatccattccgcgcagggcgcgacc
gacaaacgcagactcgccgacgccgacgaggtgctggatctgctcgccggcgggttcggc
atcgacctcaccggaatcgaggggctcggcgaccgtgtcggcgaagtcctcgacaactga

DBGET integrated database retrieval system