KEGG   Gordonia sp. MMS17-SY073: D7316_01450Help
Entry
D7316_01450       CDS       T05722                                 

Gene name
cfiB
Definition
(GenBank) 2-oxoglutarate carboxylase small subunit
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
gom  Gordonia sp. MMS17-SY073
Pathway
gom00020  Citrate cycle (TCA cycle)
gom00620  Pyruvate metabolism
gom01100  Metabolic pathways
gom01120  Microbial metabolism in diverse environments
gom01200  Carbon metabolism
gom01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    D7316_01450 (cfiB)
   00620 Pyruvate metabolism
    D7316_01450 (cfiB)
Enzymes [BR:gom01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     D7316_01450 (cfiB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RnfC_N Biotin_lipoyl_2 GCV_H ATP-grasp_4 PTS_EIIA_1
Motif
Other DBs
NCBI-ProteinID: AZG44858
UniProt: A0A3G8JIT7
Position
complement(1565019..1568408)
Genome map
AA seq 1129 aa AA seqDB search
MFDKVLVANRGEIAIRAFRAAYELGARTVAIFPYEDRNSVHRLKADESYQIGVPNHPVRA
YLSVDEVVGAAVRCGADAIYPGYGFLSENQGLAAACAQAGITFVGPSADVLELTGNKATA
VAAAKAAGLPVLASSEPSADVEELLAAAADMQFPVFVKAVAGGGGRGMRRVADPDDLADA
IAAASREADAAFGDPTVFLEQAVVNPRHIEVQILADTHGNVIHLFERDCSVQRRHQKVIE
LAPAPNLSPELREKICADAVAFAKHIGYTCAGTVEFLLDEQGRHVFIEMNPRIQVEHTVT
EEITDVDLVGSQLRIASGESLADLGLSQDRLQIRGAALQCRITTEDPANGFRPDVGRITA
YRSPGGAGVRLDGGAVLGAEVSGHFDSMLVKLTCRGRDFPTAVRRARRAVAEFRIRGVAT
NIPFLQAVLDDVDFREGRVTTSFIEDRPQLLTSRSSADRGTKILNYLADVTVNKPHGERP
TKVYPRDKLPTLDRATLASPPDGSRQRLLALGPEGFAADLRDSKRLGVTDTTFRDAHQSL
LATRVRTSGLMMVAPYVAALTPQLLSVECWGGATYDVALRFLKEDPWDRLAQLREAIPNI
CLQMLLRGANTVGYTPYPTKVTTAFVAEATEVGIDIFRIFDALNNIDQMRPAIDAVRETG
TAVAEVAMSYTGDLANPDEDLYTLDYYLRLAEQIVDAGAHVLAIKDMAGLLRAPAATTLV
SALRKEFDLPVHVHTHDTPGGQLATYLAAWQAGASAVDGASAALAGTTSQPALSAIVAAA
AHTDRDTGLDLQAVCDLEPYWEALRKVYAPFESGLPAPTGRVYTHEIPGGQLSNLRQQAI
ALGLGNRFEAVEEAYAAADRMLGRLIKVTPSSKVVGDLALALVGRGVTASEFAADPSAHD
IPDSVIGFLRGELGDPAGGWPEPLRSIALKGRGEAPPPETLTDDDSDALDIPGRKRQETL
NRLLFPAPTKEFEKHYEEFGDTSRLSANQFFYGLRYGEEHRVELEPGVQLLIGLEAISEP
DERGMRTVMCVLNGQLRPVSVRDGSVDSEVEAAERADRSNPHHIGAPFAGVVSLTVDVGD
EIAAGAAIGTIEAMKMEATITAPLGGKVARVAVGAVTQVAPGDLLIEIG
NT seq 3390 nt NT seq  +upstreamnt  +downstreamnt
gtgttcgacaaagttctggttgccaaccgtggtgagatcgcgatccgcgcattccgcgct
gcttatgaactcggggccaggacggtcgcgatcttcccgtacgaggaccggaattcggtg
catcgcctgaaggcggacgagtcgtatcagatcggtgtgccgaatcatccggtgcgtgcg
tacctgtcggtcgacgaggtcgtgggtgcggcggtgcggtgtggtgccgatgccatctat
ccgggttacggcttcctgtcggagaatcagggtctggcggcggcgtgcgcgcaggcgggt
atcacgttcgtgggtccgtcggcggatgtgttggagttgaccggcaacaaggcgaccgcg
gtggcggcggcgaaggcggcgggcctgccggtgctggcgtcctcggagccctcggccgat
gtcgaggaactgttggcggccgcggcggacatgcagttcccggtgttcgtcaaggcggtg
gccggtggtggtggtcgtggtatgcggcgggtggccgatccggatgatctcgccgatgcg
atcgcggcggcctcgcgggaggcggatgcggcgttcggcgatccgacggtgttcctggag
caggcggtggtcaatccgcgccatatcgaggtgcagattctggccgacacccacggcaac
gtgatccatctgttcgagcgcgattgttcggtgcagcggcgtcatcagaaggtgatcgag
ttggcgcctgcgccgaatctgtcgccggagttgcgggagaagatctgcgcggacgcggtg
gcgttcgccaaacacatcggttacacgtgtgccggcaccgtcgagttcctgctcgatgaa
caggggcggcatgtgttcatcgagatgaacccgcggatccaggtcgagcacacggtgacc
gaggagatcaccgatgtggatctggtggggtcgcagttgcggatcgcgtcgggcgagtcg
ctggccgatctgggtctgtcgcaggatcggctgcagatccgtggcgcggcattgcagtgc
cggatcaccaccgaggatccggccaacggattccggcccgatgtcgggcggatcaccgcg
tatcgcagcccgggcggtgccggcgtgcgtctggacggtggcgcggtcctcggtgccgag
gtgtccggtcatttcgactcgatgctggtgaagttgacgtgtcggggccgcgacttcccg
accgcggtgcggcgtgcccgacgtgcggtggccgagttccggattcgtggcgtggccacc
aacattccgttcctgcaggccgtgctcgacgatgtcgatttccgtgaggggcgggtgacg
acatcgttcatcgaggaccgtccgcagctgctgacgtcgcgatcctcggccgatcgcggc
accaagatcttgaactatctcgccgatgtcacggtgaacaagccgcacggggaacgcccg
acgaaggtgtacccgcgcgacaagctgcccaccctggatcgggcgacgctggcatctccg
ccggacgggtcacggcagcgtctgttggcgctcgggcccgagggcttcgcggccgacctg
cgtgactccaagcggctcggggtcaccgacacgaccttccgtgatgcccatcagtcgctg
ctggcgacccgggtccgcacgtcgggcctgatgatggtggcaccgtatgtggcggcgttg
accccgcagttgctgtcggtggagtgctggggcggcgcgacctacgacgtggcgttgcgg
ttcctcaaggaggacccgtgggatcggctggcgcagttgcgcgaggcgattcccaacatc
tgcctgcagatgttgctgcgtggggcgaacacggtcggctacaccccgtacccgacgaag
gtgaccacggcgttcgtcgccgaggcgaccgaggtcggcatcgacatcttccgcatcttc
gatgcgctcaacaacatcgatcagatgcgcccggccatcgacgcggtccgcgagaccggt
accgcggtcgccgaggtggcgatgagctacaccggtgatctggcgaacccggacgaggac
ctctacacgctggactattacctgcggctggccgagcagatcgtcgacgccggcgcgcac
gtgctggcgatcaaggacatggcgggtctgctgcgcgccccggccgcgacgaccctggtc
tcggcgttgcgcaaggagttcgatctgccggtgcacgtgcacacccatgacacccccggc
gggcagttggccacctatctcgcggcgtggcaggccggggcgtcggcggtcgacggtgcc
agcgcggcattggccgggaccaccagccagccggcgttgtcggcgatcgtcgcggccgcg
gcgcacaccgaccgcgacaccgggctggatctgcaggccgtgtgcgatctggaaccgtac
tgggaggcgctgcgcaaggtgtacgcgccgttcgagtccgggctgcccgcaccgaccggg
cgggtctacacccatgagatcccgggcggtcagctgtcgaatctgcggcagcaggccatc
gcactcggactcggcaaccggttcgaggcggtcgaggaggcctacgccgcggccgaccgc
atgctgggccggctgatcaaggtgaccccgtcgtcgaaggtcgtcggtgacctcgcgttg
gctttggtgggccgtggcgtcaccgcgagcgagttcgccgccgacccctccgcccatgac
atcccggattcggtgatcggattcctgcgcggtgaactcggtgaccccgcaggcgggtgg
cccgaaccgttgcgcagcatcgcgttgaagggtcgcggtgaggcgccgccgccggagacg
ctgaccgacgatgattccgacgccctggacatccccgggcgcaagcggcaggagaccttg
aaccgcttgctgtttcccgctccgacgaaggagttcgagaaacactacgaggaattcggt
gacacgtcgcggctctcggcgaatcagttcttctacggcctgcgctatggcgaggagcac
cgtgtcgaactcgaacccggcgtccaactgctgatcggcctcgaagcgatcagtgagccc
gacgagcggggcatgcgcaccgtgatgtgtgtgctgaacgggcagctgcgtccggtgtcg
gtgcgcgacggctcggtggactccgaggtcgaggccgccgaacgggcggaccgctccaac
ccgcatcacatcggcgccccgttcgccggagtggtctccctgacggtcgacgtcggcgac
gagatcgccgccggtgccgccatcggcacgatcgaggcgatgaagatggaggccaccatc
accgcgccgctgggcggcaaggtcgcccgtgtcgccgtcggcgccgtcacccaggtcgcc
cccggcgacctgctcatcgagatcgggtag

DBGET integrated database retrieval system