KEGG   Gordonia sp. MMS17-SY073: D7316_02537Help
Entry
D7316_02537       CDS       T05722                                 

Gene name
mhpE
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
gom  Gordonia sp. MMS17-SY073
Pathway
gom00360  Phenylalanine metabolism
gom00362  Benzoate degradation
gom00621  Dioxin degradation
gom00622  Xylene degradation
gom01100  Metabolic pathways
gom01120  Microbial metabolism in diverse environments
gom01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gom00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    D7316_02537 (mhpE)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    D7316_02537 (mhpE)
   00622 Xylene degradation
    D7316_02537 (mhpE)
   00621 Dioxin degradation
    D7316_02537 (mhpE)
Enzymes [BR:gom01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     D7316_02537 (mhpE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm FMN_dh
Motif
Other DBs
NCBI-ProteinID: AZG45937
UniProt: A0A3G8JLH6
Position
complement(2743412..2744446)
Genome map
AA seq 344 aa AA seqDB search
MTTTLTPTSIFIQDVTLRDGMHAVRHRITPQDVGKIVAALDAAGVDAIEVAHGDGLAGGS
LNYGPGSNSDWEWIEEAAANLTHARLTTLLLPGVGTVEDLKRAYDLGVRSVRVATHCTEA
DVAAQHIGTAREMGMDVSGFLMMSHMSAPADLAGQAKLMQDYGAHCVYVTDSGGRLTMDG
VRDRVLAYRDILDERTEIGIHAHENLSLSVANSVVAVENGVTRVDASLAGHGAGAGNCPI
EAFIAVADLLEWKHGCDVFALQDAADDLVRPLQDRPVRVDRETLTLGYAGVYSSFLRHAE
AASERYGIDVRTLLMEAGRRRLVGGQEDMIIDIALTMNKERQNG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgaccaccacgctgactccgacatcgatcttcattcaggacgtcacgttgcgcgacggt
atgcatgccgtccgccaccgcatcaccccgcaggatgtcggaaagatcgtggccgccctc
gatgccgccggtgtggacgcgattgaggtcgcccacggtgacggcctcgccggtggttca
ctcaactacggcccgggctccaacagcgactgggagtggatcgaggaagccgcagcgaac
ctcacccacgcacggttgaccaccctgctgctgcccggcgtcggtaccgtcgaggatctc
aagcgcgcctacgatctcggtgtgcggtcggtgcgggtcgcgacccattgcaccgaggca
gatgtcgccgcccaacacatcggcacggcccgcgagatgggaatggacgtctccggcttc
ttgatgatgagccacatgtccgcgcccgccgatctcgccggtcaggccaagctcatgcag
gactacggggcccattgcgtgtacgtgaccgattccggtgggcgcctgacgatggatgga
gttcgggatcgcgttctcgcctaccgcgacatcctcgatgagcgcaccgagatcggaatc
cacgcgcacgagaacctgtcactgtcggtggcgaactccgtcgtcgcggtggagaacggc
gtcacccgcgtcgacgcctcactggccgggcacggtgccggcgccggtaactgccccatc
gaggccttcatcgccgtcgccgatctgctcgagtggaagcacgggtgtgacgtcttcgcg
ctacaggacgcggctgacgatctggtccgcccgctgcaggaccgcccggtacgcgtggat
cgcgaaactctgactctcgggtacgccggcgtctattcgagcttcctacgccacgccgag
gccgccagcgaacgttacgggatcgacgtacgcaccctgctgatggaggccggtcgccgc
cgactcgtcggcgggcaggaagacatgatcatcgatatcgccctcacgatgaacaaggaa
cgccagaacggttga

DBGET integrated database retrieval system