KEGG   Gordonia sp. MMS17-SY073: D7316_04909Help
Entry
D7316_04909       CDS       T05722                                 

Gene name
menC_2
Definition
(GenBank) o-succinylbenzoate synthase
  KO
K02549  O-succinylbenzoate synthase [EC:4.2.1.113]
Organism
gom  Gordonia sp. MMS17-SY073
Pathway
gom00130  Ubiquinone and other terpenoid-quinone biosynthesis
gom01100  Metabolic pathways
gom01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:gom00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    D7316_04909 (menC_2)
Enzymes [BR:gom01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.113  o-succinylbenzoate synthase
     D7316_04909 (menC_2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: MR_MLE_C FMN_dh MAAL_C IMPDH
Motif
Other DBs
NCBI-ProteinID: AZG48292
UniProt: A0A3G8JUT8
Position
5292857..5293444
Genome map
AA seq 195 aa AA seqDB search
MRIDANGMWTVDEAIRAIRAIGDVEYVEQPCATVEELAEVRRAVEVPIAADESIRKAADP
YRVVAAGAADVAIVKVAPLGGMRATLDLAENLGLPIVVSSALDSAVGIAAGVAAAAALPK
LDHACGLGTGTLFTTDVASSFVPVGGVVVPRWPGSDAVDPATVPTVGPERERWWRDRLLR
CHAVLARRATSPAGD
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
gtgcgcatcgacgccaacggcatgtggaccgtcgacgaggcgattcgcgcgatccgggcg
atcggtgacgtcgagtacgtggaacagccgtgcgccacggtcgaggaactcgccgaggtc
cgccgtgccgtcgaggtgccgatcgccgcggacgagtcgatccgtaaggcggccgatccg
taccgcgtggtggccgccggtgctgcggacgtggcgatcgtcaaggtcgcgccgctcggc
ggcatgcgggcgacgctggatctcgcggagaacctggggttgccgatcgtcgtgtcgtcg
gcgctcgactccgcggtcggaatcgcagccggggtggccgcggcggcggcgctgccgaaa
ctcgaccatgcctgcggactgggcaccggcacactcttcaccaccgacgtcgcgtcgtcg
ttcgtgccggtcggcggggttgtcgtcccacggtggccgggttcggacgccgtggacccg
gccacggtgccgacggtcggtcccgagcgcgaacggtggtggcgggatcgactcctccgg
tgtcatgccgttctggcccgtcgcgcgacgtcgccggcaggggactag

DBGET integrated database retrieval system