KEGG   Gordonia sp. MMS17-SY073: D7316_05071Help
Entry
D7316_05071       CDS       T05722                                 

Gene name
gutB_3
Definition
(GenBank) Sorbitol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
gom  Gordonia sp. MMS17-SY073
Pathway
gom00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:gom00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    D7316_05071 (gutB_3)
Enzymes [BR:gom01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     D7316_05071 (gutB_3)
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     D7316_05071 (gutB_3)
    1.1.1.-  
     D7316_05071 (gutB_3)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 PALP FAD_binding_3 HI0933_like
Motif
Other DBs
NCBI-ProteinID: AZG48454
UniProt: A0A3G8JTH3
Position
complement(5550269..5551348)
Genome map
AA seq 359 aa AA seqDB search
MRAARYYDRGDIRIEEITEPEVGPGMVGIDVAWCGICGTDLHEYAEGPIFIPPAGHPQPI
SKESAPVTIGHEMSGVVYAVGPDVDDVSVGDHVVVEPYILYDDVDTGPASHDYHLSADMN
FIGLGGCGGGLAEKISVKRRWVHPISSSIPLDQAALIEPLSVGYHAVERSGAQAGAVALI
TGAGPIGLLTAAVCKARGITTIISEPSSMRRQKALDAGVGDHIVDPTSEDVVARVKELTV
DGRGADVGFECTSVQPALDTLFDALKPTGVLVVVSIWSHPGSVEMQKLVLKEIDMRGTIA
YVNDHPAAIALVEEGKVDLAPFITGRIGLDNLIDEGYETLIHRNETAVKILVSPSGAGV
NT seq 1080 nt NT seq  +upstreamnt  +downstreamnt
atgcgggcagcacgctactacgaccggggcgacatcaggatcgaagagatcaccgaaccc
gaggtgggccccggcatggtggggatcgacgtcgcctggtgcgggatctgcggtacggac
ctgcatgaatacgccgagggaccgatcttcatcccgccggccggtcatccccaacccatc
agcaaggagagtgcgccggtcaccatcggacacgagatgtccggggtcgtgtacgcggtg
ggccccgacgtcgacgacgtgtcggtcggcgatcatgtcgtcgtggagccgtacatcctg
tacgacgatgtcgacaccggaccggccagccacgactatcacctgtcggcggacatgaat
ttcatcgggctcggcggctgcggcggcgggctcgcggagaagatctcggtgaagcgtcgc
tgggtgcacccgatctcgtcgagcatcccactcgatcaggccgccctcatcgaaccgctg
tcggtcggctaccacgccgtcgaacgcagcggcgcacaagcgggcgcggtcgccctgatc
accggcgccggcccgatcggtctgctcaccgccgcggtctgcaaggcgcgcggcatcacg
acgatcatcagcgaaccgagttcgatgcgacgtcagaaggccctcgacgccggggtcggc
gaccacatcgtcgaccccaccagcgaggacgtcgtcgccagggtcaaggagctgaccgtc
gacggccgcggcgccgacgtcgggttcgagtgcacctccgtgcagccggccctcgacacc
ctcttcgacgccctgaagcccaccggtgtgctcgtcgtcgtgtcgatctggagccacccg
ggatcggtcgagatgcagaagctggtgctcaaggagatcgacatgcgcggcaccatcgcc
tacgtcaacgatcatcccgcagcgatcgcgctggtcgaggagggcaaggtcgacctcgcg
ccgttcatcaccgggaggatcggcctcgacaacctgatcgacgagggatatgagaccctg
atccaccgcaacgagacagcggtcaagatcctggtgtcgccctccggggccggtgtgtga

DBGET integrated database retrieval system