KEGG   Gordonia phthalatica: ACH46_02255Help
Entry
ACH46_02255       CDS       T04097                                 

Definition
(GenBank) zinc-containing alcohol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
goq  Gordonia phthalatica
Pathway
goq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACH46_02255
Enzymes [BR:goq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ACH46_02255
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ACH46_02255
    1.1.1.-  
     ACH46_02255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C FAD_binding_3 Shikimate_DH NAD_binding_7
Motif
Other DBs
NCBI-ProteinID: ALG83543
UniProt: A0A0N7FU71
Position
487504..488550
Genome map
AA seq 348 aa AA seqDB search
MKSLLLYAARDARIADVPEPEPGPGQVKVKVECAGICGSDLSLFQYSPIPAGFTHPLLCT
HGPHALGHEFSGRVVALGDGVDDIEVGALVAVRPNVYDGTCPACERGEQNLCAQGGFIGV
SGGGGGFSEYVVAGRDAAHVIPERFGAEVAAMVESTAVAWHAVKQSGGGDGTTALVVGAG
PVGLALVSCLLARGASKVFVSELSEARKARAVEMGAEVLDPSQTDVVAHVQALGGVDVSF
DASGVGQPTYDTALDALRPGGTSVVVAMFHEPVQVDLQKYMTSEKKLVGSMAYTDVDFGE
VVEAIVDGRLDPRPLITGRIRLDDVVDKGLNHLLGEGRNSEIKILVTP
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatcgttgctgctgtatgccgcccgggacgctcggatcgccgacgtcccggaaccg
gaacccggccccggccaggtgaaggtcaaggtggagtgcgcgggcatctgcggatccgac
ctctcgctgttccagtactcgccgatcccggcgggattcacccatccgctgctgtgcaca
cacggcccgcacgcgctggggcatgagttctccggacgcgtggtcgcgctcggcgacggc
gtcgacgacatcgaggtcggcgcgctggtcgcggtgcgccccaacgtctacgacggcacc
tgcccggcctgcgaacgcggtgagcagaacctctgcgcgcagggcggcttcatcggcgtc
agcggcgggggaggcggcttcagcgagtacgtcgtcgcgggccgcgacgcggcgcacgtg
atccccgaacggttcggtgccgaggtggccgcgatggtcgagtcgacggcggtcgcctgg
cacgcggtgaagcagtcgggcgggggcgacggcaccacggcgctggtcgtcggagccggc
cccgtcggactggcgctggtgtcctgcctcctggcgcgcggcgcgtcgaaggtcttcgtc
agtgaactcagcgaggcgcgcaaggcgcgcgccgtcgagatgggcgcggaagttctggac
ccgagccagacggatgtcgtggcgcacgtacaggcactcggcggcgtcgacgtctccttc
gacgcgtccggcgtcggccagcccacctacgacaccgcgctcgacgcgctccgtcccggc
ggcacgtcggtcgtcgtcgcgatgttccacgaaccggtccaggtggacctgcagaagtac
atgacgagcgagaagaagctggtcggatccatggcctacacggacgtggacttcggcgag
gtggtggaggcgatcgtcgacggccgcctggacccgcgcccgctcatcaccgggcgcatc
cgactcgacgacgtcgtcgacaagggcctgaaccatctgctcggtgagggtcggaacagc
gagatcaagatcctcgtgactccgtga

DBGET integrated database retrieval system