KEGG   Gordonia phthalatica: ACH46_02940Help
Entry
ACH46_02940       CDS       T04097                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
goq  Gordonia phthalatica
Pathway
goq00480  Glutathione metabolism
goq00590  Arachidonic acid metabolism
goq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    ACH46_02940
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    ACH46_02940
Enzymes [BR:goq01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     ACH46_02940
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx AhpC-TSA Redoxin
Motif
Other DBs
NCBI-ProteinID: ALG83648
UniProt: A0A0N9N923
Position
633734..634225
Genome map
AA seq 163 aa AA seqDB search
MGHANIKEIPVRALDGGEFSLAGLTGPLLVVNVASKCGLTPQYTALEKLQKDYGDRGLTV
VGVPCNQFMGQEPGTAEEIATFCSTTYGVTFPLLEKTDVNGDDRHPLYAELTQTPDANGE
AGDIQWNFEKFLVAADGTVAARFRPRTEPDAPEVVSAIEAALG
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgggtcacgccaacatcaaagaaattcctgtccgcgctctcgacggcggtgagttctcc
ctcgcaggcctcaccggaccgctgctcgtggtgaacgtcgcgtccaagtgcggcctcact
ccccagtacaccgcgctcgagaagctgcagaaggactacggcgaccgcggcctcaccgtc
gtcggcgttccgtgcaaccagttcatggggcaggagcccggcaccgccgaggagatcgcc
accttctgttccaccacctacggcgtcaccttcccgctgctggagaagaccgacgtgaac
ggcgacgaccgccacccgctgtacgccgaactgacgcagacgcccgacgcgaacggcgag
gccggcgacatccagtggaacttcgagaagttcctcgtcgccgccgacggcaccgtcgcg
gcccgcttccgtccgcgcaccgagcccgacgccccggaagtcgtctcggccatcgaggcg
gccctcggttag

DBGET integrated database retrieval system