KEGG   Gordonia phthalatica: ACH46_04545Help
Entry
ACH46_04545       CDS       T04097                                 

Definition
(GenBank) methionine--tRNA ligase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
goq  Gordonia phthalatica
Pathway
goq00450  Selenocompound metabolism
goq00970  Aminoacyl-tRNA biosynthesis
goq01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ACH46_04545
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ACH46_04545
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:goq01007]
    ACH46_04545
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:goq03016]
    ACH46_04545
Enzymes [BR:goq01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ACH46_04545
Amino acid related enzymes [BR:goq01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ACH46_04545
Transfer RNA biogenesis [BR:goq03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ACH46_04545
 Prokaryotic type
   Other AARSs
    ACH46_04545
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ALG83916
UniProt: A0A0N9MP43
Position
complement(972282..973853)
Genome map
AA seq 523 aa AA seqDB search
MPSESFGASSPFYITTAIAYPNGAPHIGHAYEFISADVLARFKSLDGFDVRFQSGTDEHG
QKMQQTAEKQGVSTAELAKTNSDRFEALHTALGTDLSRFIRTTDADHHRASEEIWKRMEA
GGDIYLDTYAGWYDVRDEAFFTEDETTVDDDGNRVATENGHVLTWTEEQTYFFRLSQYQD
RLLALYDSRPEFIGPDVRRNEVRAFVAGGLNDLSISRTTFDWGVPVPGAPEHVMYVWVDA
LTNYLTGVGFPDDEQMLERYWPASLHIIGKDIIRFHCVYWPAFLMSAGIEVPERVFAHGF
LFNRGEKMSKSVGNVVDPHELVAQFGLDAVRFFFLREVSYGQDGSYSAEAIVSRNNADLA
NEYGNLAQRTLSMIGKYFESTVPTPAAYTAEDTALLDAADALLPKVRDLFDRQAIHQGIE
ALWSVLADTNRYISAQEPWKLAKTDLERTGTVLYVCAEVVRIVTLLAQPVMPGSTSTLLD
LLCVDADPQARQFTAVADRLVPGTALPKPTPVFPRQDMPAADA
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atgccgagcgagtcctttggcgcgtcgtcgcccttctacatcaccaccgccatcgcgtat
ccgaacggcgccccgcacatcgggcacgcctacgagttcatctcggcggacgtgctggca
cggttcaagtcgctggacggattcgacgtccgcttccagtcgggcaccgacgagcacggt
cagaagatgcagcagaccgcggagaagcagggtgtgtcgacggccgagctggcgaagacc
aactccgaccgcttcgaagccctccacaccgcgctcggcaccgatctgagccggttcatc
cgcaccaccgacgccgaccaccatcgtgcgtcggaggagatctggaagcggatggaagcg
ggcggcgacatctacctcgacacctatgccggctggtacgacgtccgcgacgaggccttc
ttcaccgaggacgagacgacggtcgacgacgacggcaaccgggtcgccaccgagaacggc
cacgtcttgacgtggaccgaggagcagacctacttcttccgcctgtcccagtaccaggac
cgcctgctggccctctacgacagccgccccgagttcatcggccccgatgtccgccgcaac
gaggtccgcgccttcgtggccggcggcctcaacgacctctcgatctcgcgcaccacgttc
gactggggagtcccggtcccgggcgcccccgagcacgtcatgtacgtgtgggtggacgcg
ctgaccaactacctgaccggtgtcggcttccccgacgacgagcagatgctggagcgctac
tggccggccagcctgcacatcatcggcaaggacatcatccggttccactgcgtgtactgg
cccgcgttcttgatgagcgccgggatcgaggtccccgagcgtgtcttcgcgcacggcttc
ctgttcaaccgcggcgagaagatgagcaagtcggtcggaaacgtggtcgacccgcacgag
ctggtggcccagttcggtctggacgccgtccggttcttcttcctccgcgaggtgtcgtac
gggcaggacggctcgtactcggcggaggccatcgtctcccgcaacaacgccgacctcgcc
aacgagtacggcaacctggcacagcgcacgctgagcatgatcggcaagtacttcgagtcg
accgttccgacaccggccgcgtacaccgccgaggacaccgccctgctcgacgccgccgac
gcgctgctgccgaaggtccgcgacctcttcgaccgccaggccatccaccagggcatcgag
gccctgtggtcggtgctggccgacaccaaccgctacatctccgcgcaggagccgtggaag
ctggccaagaccgatctggagcgcaccggcaccgtcctgtacgtgtgcgccgaggtggtc
cggatcgtcacgctgctggcgcagccggtgatgccgggctccacgtccaccctgctcgac
ctgctgtgcgtcgacgccgacccgcaggcgcggcagttcaccgccgtcgccgaccgcctg
gttccggggaccgcgctgccgaagccgacgccggtgttcccccgccaggacatgcccgcc
gccgacgcatga

DBGET integrated database retrieval system