KEGG   Gordonia phthalatica: ACH46_06735Help
Entry
ACH46_06735       CDS       T04097                                 

Definition
(GenBank) pyruvate carboxylase
  KO
K01958  pyruvate carboxylase [EC:6.4.1.1]
Organism
goq  Gordonia phthalatica
Pathway
goq00020  Citrate cycle (TCA cycle)
goq00620  Pyruvate metabolism
goq01100  Metabolic pathways
goq01120  Microbial metabolism in diverse environments
goq01200  Carbon metabolism
goq01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    ACH46_06735
   00620 Pyruvate metabolism
    ACH46_06735
Enzymes [BR:goq01000]
 6. Ligases
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.1  pyruvate carboxylase
     ACH46_06735
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 PYC_OADA Biotin_carb_N Biotin_carb_C HMGL-like Biotin_lipoyl Dala_Dala_lig_C RnfC_N ATP-grasp_3 GCV_H
Motif
Other DBs
NCBI-ProteinID: ALG84256
UniProt: A0A0N9NF57
Position
1441354..1444749
Genome map
AA seq 1131 aa AA seqDB search
MSGVAKILVANRGEIAVRAFRAARDLGIGTVAVYPHEDRGSIHRFKADESYQIGTPGHPV
KAYLSVEEMIGAALRSGADAVYPGYGFLSENAGLARACAENGVTFIGPAASVLDLTGDKK
RSVQAAREAGLPVLAGSAPSSDPDELVEAAANMTFPVFVKAIAGGGGRGMRRVERIGDLA
DAVTSASREAQTAFGDPTVFLEQAVVEPRHIEVQILADTHGDVVHLYERDCSLQRRHQKV
VEIAPAVGLDSAVRERICRDAVAFAQQIGYACAGTVEFLLDQRGQHFFIEMNPRIQVEHT
VTEEVVDVDLVSAQLQIAGGASLADLGLSQETITVHGAAMQCRITTEDPADGFRPQTGRV
RDYRAPGGAGVRLDGAAALGSEVTGHFDSMLVKLTCRGRDFPTAAARARRALGEFSIRGV
TTNIGFLRAVLENEEFLAGGTTTSFIQTHPELLDGHIQGDDVGKLLHYLADVTVNRPHGD
APTSVRPTSKLPAVPTSRLARPPAGSRQQLLELGPEGFARALRNQKAVAITDTTFRDAHQ
SLLATRLRTSALDAVSRHVAALTPQLWSVECWGGATYDVALRFLREDPWQRLEKLREGMP
NICLQMLLRGANTVGYTPYPDDVCRGFVAEAAATGVDVFRIFDALNSVDAMRPAIDAVRE
TGTAVAQVAMSYSGDLSDPREDLYTLDYYLSLAQRIVDAGAHVLAIKDMAGLLRPRAATA
LVGALRREFDLPIHVHTHDTAGGQVATYLAAIAAGADAVDAASAPLSGTTSQPSLSAVVA
ALENGEQDTGLDLGAVCSLEPYWEAVRRVYAPFESGVGAATGRVYEHEIPGGQLSNLRQQ
AISLGVGHRFEEVEQAYADADRLLGRPIKVTPSSKVVGDLALSLVAQQISAEDFAADPSA
HDVPDSVIGFLSGDLGVPAAGWPEPLRTKVLGGRSRTAPSADLAAEDQAVLRRPGPQRRR
ALDRLLFPGPAEDFTDHRARFGDTSRLSATEFFYGLRPGEEHRVRLGPGSEMLVGIEAVG
EPDDLGRRTVLFTVNGTLRPVLVEDRSVEPSTVVAERADRGDPRQIGAPFAGVVTVTVSE
GDSVPAGATIGTIEAMKMEASITAPIGGVVKRVAVGGVTEVAPGDLLVEIG
NT seq 3396 nt NT seq  +upstreamnt  +downstreamnt
atgagcggcgtagcgaagatcctcgtcgccaaccggggggagatcgcggtccgcgccttc
cgcgcggcccgtgacctcggaatcggcaccgtggccgtgtacccgcacgaggaccgcggc
agcattcaccgcttcaaagccgacgagtcgtaccagatcggcacgcccggacatccggtc
aaggcgtacctgtcggtcgaggagatgatcggcgccgctctccggtcgggcgccgacgcg
gtctatccgggatacggcttcctgtccgagaacgcggggctggctcgggcgtgcgccgag
aacggtgtgacgttcatcggtccggccgcctcggtcctcgacctgaccggcgacaagaag
cgctcggtgcaggcggctcgtgaagcgggcctgccggttctcgcgggctcggcgccgtcg
tcggatcccgacgagctcgtcgaggccgccgcaaacatgacctttccggtcttcgtcaag
gcgatcgcgggcggcggcggccgcggaatgcgtcgcgtggaacgcatcggggatctcgcc
gacgcggtgacctccgcgagccgcgaagcccagacggccttcggcgatccgaccgtgttc
ctggagcaggccgttgtggagccgcgacacatcgaggtgcagatcttggcggacacccac
ggcgacgtggtccatctgtacgagcgggactgcagtctgcagcggcgtcatcagaaggtc
gtcgagatcgcgccggccgtcggtctggattccgctgtgcgcgagcggatctgccgcgac
gccgtcgctttcgcacagcagatcggctacgcctgtgcgggtaccgtcgagttcctgctc
gatcagcgcgggcagcacttcttcatcgagatgaatccgcgcatccaggtcgagcacacg
gtgaccgaagaggtcgtcgatgtggacctggtgtcggcgcagctgcagatcgccggtggc
gcatcgctcgccgatctcggcctgagccaggagacgatcaccgtgcacggcgccgcgatg
cagtgccgcatcaccaccgaggatccggccgacgggttccggcctcagaccggccgagtg
cgcgactaccgggcgccgggcggagcgggcgtccggctcgacggcgccgcggcgctgggc
agcgaggtgaccggtcacttcgactcgatgctggtgaagctgacctgtcgcgggcgggac
ttcccgaccgcggcggcccgggcacgccgcgcgctgggggagttctcgatccgcggtgtc
acgacgaacatcggcttcctgcgtgcggtcctggagaacgaggaattcctggcaggcggg
acgacgacgtcgttcatccaaacgcatcccgagctgctcgacgggcacatccagggagac
gatgtcggcaagctgctgcactacctggccgacgtgacggtgaatcggccgcacggcgac
gcaccgacgtcggtcaggccgacctcgaagctgcccgcagttcctacgagtcgactggcc
cggccgcccgccggctcgcgtcagcaactgctggagctgggaccggaggggttcgctcgg
gcactgcggaaccagaaggcggtggcgatcaccgacaccacgttccgtgacgcccatcag
tcgctgctcgcgacccgactgcgcaccagtgcgctcgacgcggtgtctcgtcacgtcgcg
gcactcactccgcaactgtggtccgtcgaatgctggggaggtgcgacctacgacgtcgca
ctccggttcctgcgtgaggacccgtggcagcggctggagaagctccgcgagggcatgccg
aacatctgtctgcagatgctgctgcgtggcgccaacaccgtcgggtacacgccctatccg
gacgacgtctgtcgcggattcgtcgccgaggccgccgcgacgggtgtggacgtcttccgc
atcttcgacgccctcaacagcgtcgacgcgatgcggccggcgatcgacgcggtccgggag
acgggaaccgcggtcgcccaggtggcgatgagctacagcggagacctctcggatccgcgg
gaggatctgtacacgctcgactactacctgagcctcgcgcagcggatcgtcgatgcgggc
gcgcatgtgctggcgatcaaggacatggccggactgctgcgtccacgggccgcgacggcc
ctggtcggggcgttgcgccgagagttcgatctgccgatccacgtgcacacccacgacacc
gcgggcggacaggtggcgacctacctggcggcgatcgccgcgggcgccgacgccgtcgac
gccgcgagcgcgccgctgtcgggcacgacgagccagccgtcactgtcggcggtggtggcg
gcattggagaacggcgaacaggacaccgggctggacttgggtgccgtgtgttcgctggaa
ccgtactgggaggccgtgcgccgggtgtacgcccccttcgaatcgggagtcggcgctgcg
accggccgtgtctacgagcacgagatccccggcggacagctgtcgaacctgcgccagcag
gcgatctcgctcggcgtcgggcatcggttcgaggaggtcgagcaggcctacgcggacgcg
gaccggctgctcgggcggccgatcaaggtgaccccgtcatcgaaggtcgtcggcgatctg
gcactgtctctggtcgctcagcagatcagcgccgaggacttcgccgccgatccgtcggcg
cacgatgtgcccgactcggtcatcgggttcctgtccggcgacctcggagttccggcggcg
ggctggccggagccgctacgcaccaaggtcctcgggggacgatcgcgcaccgcgccgagc
gctgatctcgcggcggaggaccaggcggtgctgcgccgcccgggaccacagcggcgtcgg
gcgctcgaccggctgctgttccccgggcctgcggaggatttcaccgaccaccgcgcgcgc
ttcggcgacacctctcgactgtcggcgacggagttcttctacggcctgcggccgggtgag
gaacaccgcgtccggctgggaccaggcagcgagatgctggtcggcatcgaagccgtcggc
gaacccgacgacctgggacggcggacagtgctgttcactgtgaacggaaccttgcgtccg
gtgctggtggaggaccggtccgtcgagccgtcgaccgtcgtcgccgaacgcgccgaccgc
ggcgacccgcgccagatcggcgcgcccttcgcgggcgtggtcacggtgacggtctccgag
ggggactccgtccccgccggcgcgaccatcggcaccatcgaggcgatgaagatggaggcc
tcgatcactgcgccgatcggcggcgtcgtcaagcgggtggccgtcggaggcgtgacggag
gtggcgccgggggatctgctcgtcgagatcggctga

DBGET integrated database retrieval system