KEGG   Gordonia phthalatica: ACH46_17480Help
Entry
ACH46_17480       CDS       T04097                                 

Definition
(GenBank) 2,3-butanediol dehydrogenase
  KO
K00004  (R,R)-butanediol dehydrogenase / meso-butanediol dehydrogenase / diacetyl reductase [EC:1.1.1.4 1.1.1.- 1.1.1.303]
Organism
goq  Gordonia phthalatica
Pathway
goq00650  Butanoate metabolism
Brite
KEGG Orthology (KO) [BR:goq00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    ACH46_17480
Enzymes [BR:goq01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.4  (R,R)-butanediol dehydrogenase
     ACH46_17480
    1.1.1.303  diacetyl reductase [(R)-acetoin forming]
     ACH46_17480
    1.1.1.-  
     ACH46_17480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C ADH_zinc_N_2 2-Hacid_dh_C TrkA_N Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: ALG85953
UniProt: A0A0N9NE05
Position
3717322..3718398
Genome map
AA seq 358 aa AA seqDB search
MRAARYYDRGDVRIENIDDPVVQPRMVGIDVAWCGICGTDLHEYADGPIFIPPAHHPQPL
SGESAPVTIGHEMSGVVSSVGEGVTDLAVGDHVVVEPYIIADDVDTGPDSHDYHLSPDMN
FIGLGGCGGGLAERIAVKRRWVHKISPSVPLDQAALIEPLAVGFHAVQRSGAGAGAVALI
TGAGPIGLLTAANCRARGISVIISEPSPLRRAKATETGVADHVLDPASEDVLARVRELTG
GRGADVGFECTSVQAALDTLLDALKPTAVLVVVSIWGHPASVDMQKLVLKEIDMRGTIAY
VNSHPETIALVESGEIDLAPFITGKIGLDQLVSEGYDTLLHRNETAVKILVSPSGAGL
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgagagccgcccgctactacgaccgcggagacgtccgcatcgagaacatcgacgatccc
gtcgtgcagccgagaatggtgggcatcgacgtcgcctggtgcggcatctgcggcaccgat
ctccacgagtacgccgacggtccgatcttcatcccgcccgcacaccatccgcagccgctc
agcggtgagagcgcgccggtcaccatcggccacgagatgtccggcgtggtgtcctcggtc
ggcgagggcgtcaccgacctggccgtcggcgaccacgtggtggtggagccgtacatcatc
gccgacgacgtcgacaccggccccgacagccacgactaccacctctctcccgacatgaac
ttcatcggcctcggcgggtgcggcggcgggctcgccgagcggatcgccgtgaaacggcgc
tgggtgcacaagatctcgccgtcggtcccgctcgatcaagccgcgctgatcgagccgctc
gccgtcggcttccacgcagtccagcgcagcggagccggcgccggggccgtcgcgctgatc
accggtgccggcccgatcggcctgctgacggccgccaactgccgagcgcgcggcatctcg
gtgatcatcagcgagcccagcccgctgcgccgcgcgaaggcgaccgagaccggggtcgcc
gaccacgttctcgatccggcgtcggaggacgtcctcgcccgggtgcgcgagctgaccggc
ggccgcggcgccgatgtgggtttcgaatgcacgtcggtgcaggccgccctcgacaccctg
ctcgacgcgctcaagccgaccgccgtcctggtggtggtgtcgatctgggggcacccggcc
tccgtcgacatgcagaagctggtgctcaaggagatcgacatgcgcggcaccatcgcctac
gtgaacagccacccggagacgatcgcgttggtcgagagcggcgagatcgacctcgccccg
ttcatcaccggcaagatcggcctcgaccagctggtcagcgaaggttacgacaccctgctg
caccgcaacgagacggcggtcaagatcctggtctcgccgtccggcgccggtctctga

DBGET integrated database retrieval system