KEGG   Gordonia sp. KTR9: KTR9_0812Help
Entry
KTR9_0812         CDS       T02216                                 

Gene name
hsaF
Definition
(GenBank) 4-hydroxy-2-oxovalerate aldolase
  KO
K01666  4-hydroxy 2-oxovalerate aldolase [EC:4.1.3.39]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00360  Phenylalanine metabolism
gor00362  Benzoate degradation
gor00621  Dioxin degradation
gor00622  Xylene degradation
gor01100  Metabolic pathways
gor01120  Microbial metabolism in diverse environments
gor01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00360 Phenylalanine metabolism
    KTR9_0812 (hsaF)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KTR9_0812 (hsaF)
   00622 Xylene degradation
    KTR9_0812 (hsaF)
   00621 Dioxin degradation
    KTR9_0812 (hsaF)
Enzymes [BR:gor01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.39  4-hydroxy-2-oxovalerate aldolase
     KTR9_0812 (hsaF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like DmpG_comm
Motif
Other DBs
NCBI-ProteinID: AFR47465
UniProt: J9S2F7
Position
904793..905887
Genome map
AA seq 364 aa AA seqDB search
MSTNVVLTPRDPKLMANARKYSDTLDIRITDSSLRDGSHHKRHQFTEDEVRAIVGALDEA
GVPVIEVTHGDGLGGSSFNYGFSKTPEQQLIKAAAETAKRAKIAFLMLPGLGTKDDIRAA
QDNGGQICRIATHCTEADVSIQHFGLARDLGLETVGFLMMSHSQPPEVIAKQARIMADAG
CQCVYVVDSAGALVLEDVTVRVEALVAELGNDAQVGFHGHENLDIAVANSVNAIRAGAQQ
IDGSIRRFGAGAGNTPTEAFVGVCDKLGITTGVDFMKIADAAQDVVRPAMPSECLVDRSA
MMMGYAGCYSSFLKHAEGHAERYGVSAAEILLEAGSRKLVGGQEDQLIDIALELKKKQDA
NAGV
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccaatgtggttctgacaccgcgcgacccgaagctgatggcgaacgcgcgcaag
tactccgacaccctcgacatccgcatcacggactcgtcgctgcgtgacggtagccaccac
aagcgccaccagttcaccgaggacgaggtccgcgcgatcgtcggcgcactcgacgaggcg
ggtgtgccggtgatcgaggtgacccacggtgacggtctgggcgggtcgtcgttcaactac
ggcttctccaaaactcctgagcagcaattgatcaaggccgccgcggagactgcgaagcgc
gcgaagatcgcgttcctgatgctgcccgggttgggcaccaaggacgacatccgggccgcg
caggacaacggcggccagatctgccgcatcgcgacgcactgcaccgaggccgatgtctcc
atccagcacttcggactcgcccgcgatctgggcctggaaaccgtcgggttcctgatgatg
agccacagccagccgccggaggtcatcgccaagcaggcccgcatcatggccgatgccgga
tgtcagtgtgtctacgtcgtcgactccgcgggtgccctcgtcctcgaagacgtgaccgtg
cgggtggaggccctggtggccgaactcggcaacgacgcgcaggtcgggttccacggtcat
gagaacctcgacatcgcggttgccaactcggtcaacgcgattcgtgcgggtgcgcagcag
atcgacggctcgatccggcgcttcggtgcgggcgcgggcaacacacccaccgaggccttc
gtgggtgtgtgcgacaagctcggcatcaccaccggagtcgatttcatgaagatcgccgac
gccgcacaggatgtcgtccgtccggccatgccgtcggagtgcctggtcgaccgctcggcg
atgatgatgggctacgccggttgctacagctcgttcctcaagcatgccgagggtcacgcc
gaacgctatggcgtctcggcggcggagatcctcctcgaggcgggcagccgcaaactagtc
ggaggtcaggaagaccagctgatcgacatcgcgctcgaactcaagaaaaagcaggacgcg
aacgccggggtgtga

DBGET integrated database retrieval system