KEGG   Gordonia sp. KTR9: KTR9_1419Help
Entry
KTR9_1419         CDS       T02216                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00450  Selenocompound metabolism
gor00970  Aminoacyl-tRNA biosynthesis
gor01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KTR9_1419
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KTR9_1419
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:gor01007]
    KTR9_1419
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:gor03016]
    KTR9_1419
Enzymes [BR:gor01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KTR9_1419
Amino acid related enzymes [BR:gor01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KTR9_1419
Transfer RNA biogenesis [BR:gor03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KTR9_1419
 Prokaryotic type
   Other AARSs
    KTR9_1419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f SEA
Motif
Other DBs
NCBI-ProteinID: AFR48059
UniProt: J9SBQ3
Position
complement(1607231..1608841)
Genome map
AA seq 536 aa AA seqDB search
MSSPPIGSLLGTMAPDLTSPDPSGTSHGGGRPYYITTAIAYPNGAPHIGHAYEYISADAL
ARFKRLDGFDVRFLTGTDVHGQKMQQTANAEGIPTAELANRNSDRFQALQERLGSSFDRF
IRTSDEDHKRASEEIWRRMSDRGDIYLDKYSGWYDVRDETFYGEGDTELNEAGDRVAADT
GHVLTWTEEETYFFRLSAYQDKLLELYESRPDFIGPDVRRNEVISFVKGGLTDLSVSRTT
FDWGVPVPDHPEHVMYVWVDALTNYLTGVGFVDDPETFARYWPADLHIIGKDIIRFHCVY
WPAFLMSAGIDLPERVFAHGFLFNKGEKMSKSVGNVVDPENLIDEFGLDPVRYFFLREVS
YGQDGSYSAEAIVSRINADLANEFGNLTQRTLSMVGKYFDGTLPAPGELTETDAALLARA
DSLLDTVRTHIDNQAIHLALEALWSTLAETNRYISAQEPWKLAKADLERTGTVLYVCAEV
VRIVALLSQPVMPESSGKILDLLVVGEDRRFTAVGTRLEPGTALPKPSPVFPRYEN
NT seq 1611 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgtctccaccgatcggtagtctgttgggcactatggcacccgatctgaccagccct
gatccgtccggtacctcccacggcggcggacgcccgtactacatcaccaccgcgatcgcc
taccccaacggcgctccgcacatcgggcacgcctacgagtacatctcggccgacgccctg
gcacggttcaagcgactcgacggcttcgacgtccggttcctgaccggcaccgacgtccac
gggcagaagatgcagcagaccgcgaacgccgagggcatccccaccgcagagctcgccaac
cggaactccgaccggttccaggcgctgcaggagcggctggggtccagcttcgatcgcttc
atccggacctcagacgaggaccacaagcgggcatcggaagagatctggcggcgcatgagc
gaccgcggcgacatctacctcgacaagtactccggctggtacgacgtccgcgacgagacc
ttctacggcgagggcgacaccgagctcaacgaggccggcgaccgggtggccgccgacacc
gggcacgtgctgacctggaccgaggaggagacctacttcttccggctttccgcctaccag
gacaaactgctcgagctgtacgagtcgcgacccgacttcatcggccccgacgtccggcgc
aacgaggtcatcagcttcgtcaagggcggcctgaccgacctgtcggtgtcgcgcaccacc
ttcgactggggcgtgccggtccccgaccatcccgaacacgtcatgtacgtgtgggtcgac
gcgctcaccaactacctcaccggcgtcgggttcgtcgacgacccggagacgttcgcccgc
tactggcccgccgacctgcacatcatcggcaaggacatcatccggttccactgcgtgtac
tggcctgccttcctcatgagcgcgggtatcgacctgcccgagcgggtcttcgcgcacgga
ttcctgttcaacaagggcgagaagatgagcaaatcggtcggcaacgtcgtcgacccggag
aacctcatcgacgagttcggcctcgatccggtgcgctacttcttcctccgcgaggtgtcc
tacggtcaggacggttcgtattccgccgaggcgatcgtgtcccgcatcaacgccgacctc
gccaacgagttcggcaatctgacccagcgcacgctgtcgatggtcggcaagtacttcgac
ggcaccctgccggcgccgggcgagctcaccgagaccgacgccgcgctgctggcgcgtgcc
gactcgctgctcgacaccgtgcgaacccacatcgacaaccaggcgatccacctggcactc
gaggccctgtggtcgacgctggccgagaccaaccggtacatctccgcgcaggaaccgtgg
aaactggcgaaggccgatctcgagcgcaccggcacggtgctctacgtctgcgccgaggtc
gtgcgcatcgtcgcactcctgagccagccggtcatgccggagtcgtccggcaagatcctc
gacctcctcgtcgtcggcgaggaccgtcgattcaccgccgtgggcacccgcctggagccc
ggcaccgcgctgccgaagccgtctccggtgttccctcggtacgagaactga

DBGET integrated database retrieval system