KEGG   Gordonia sp. KTR9: KTR9_1668Help
Entry
KTR9_1668         CDS       T02216                                 

Gene name
choD
Definition
(GenBank) Cholesterol oxidase
  KO
K03333  cholesterol oxidase [EC:1.1.3.6]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00984  Steroid degradation
gor01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gor00001]
 Metabolism
  Xenobiotics biodegradation and metabolism
   00984 Steroid degradation
    KTR9_1668 (choD)
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.3  With oxygen as acceptor
    1.1.3.6  cholesterol oxidase
     KTR9_1668 (choD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GMC_oxred_N GMC_oxred_C DAO FAD_binding_2 Pyr_redox_2 NAD_binding_8 Pyr_redox FAD_binding_3 Fer4_9 Fer4_8 Fer4 Fer4_10 Fer4_7 Fer4_6 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AFR51382
UniProt: J9RTS7
Position
1888880..1890676
Genome map
AA seq 598 aa AA seqDB search
MTMHVSMVAMGFDRSTERATDFDVLIVGSGFGGSVSALRLVEKGYRVGVVEAGRRFEDED
FAKTSWRLNRWLWAPKLGLYGIQRIHALKDVMILAGAGVGGGSLNYANTLYKPPTPFFTD
PQWNHITDWEDELGPYYDQARRMLGVVTNPTVTASDRVVAEVAAEMGVGDTVTPTPVGVF
FGAKTGLAGAPGETVRDPYFGGAGPDRTACTECGACMTGCRVGAKNTLLKNYLGLAERNG
ATIIDRTTVDSLHQRADGVWEVGTHHSSSWGPLGRRRRTITAGQVILAAGTFNTQRLLHH
AKLGSLPRISDAMGRLTRTNSESILGAMGSRIDPENDYSRGVAITSSFYPEPNTHIEPVR
YGKGSNAIAYLQTLLTDGGSRRDRFGQFLRQVARNPFLLVRLLVVRQWSERTVIALVMQN
NNNSLTTFVRKRGPLRYVTSKQGHGEPNPTWIPKGNEATRRIAAKLNGGVAGGTWGDIVN
MPLTAHYLGGCAISDDPDNGVIDPYQRVWNYPTLHIADGASVSANLGVNPSLTICAQAER
AAALWPNKGEQDRRPAQGEPYRRIEPITPTSPVVPADAPGALRLPIIPLTPVTAQRIS
NT seq 1797 nt NT seq  +upstreamnt  +downstreamnt
gtgacaatgcacgttagtatggtcgccatgggtttcgacaggtccaccgaacgcgccacc
gacttcgacgtcctgatcgtcggctccggcttcggcggcagtgtgagtgcgttgcgtctc
gtggagaaggggtatcgcgtcggcgtcgtcgaggcgggtcgtcgtttcgaggacgaggac
ttcgccaagaccagctggcgcctcaaccggtggttgtgggccccgaagctgggtctgtac
ggcattcagcgcattcacgcgctcaaggacgtgatgatcctggccggcgctggggtcggc
ggcggatcgctcaactacgccaacaccctgtacaagcccccgacaccgttcttcaccgat
ccccagtggaaccacatcaccgactgggaggacgagctcggtccgtactacgaccaggcg
cgccggatgctcggtgtggtcaccaacccgacggtcaccgcctccgaccgcgtggtcgcc
gaagtcgccgccgagatgggtgttggcgacacggtgaccccgaccccggtcggtgtgttc
ttcggtgcgaagacgggtctggccggggcgcccggtgagaccgtccgcgacccgtatttc
ggcggtgcgggcccggaccgaaccgcctgcaccgaatgcggagcgtgcatgaccgggtgc
cgggtgggcgccaagaacaccctgctgaagaactacctcggtctcgcagaacgcaacggc
gccaccatcatcgaccgcaccacggtggactctctgcaccagcgcgccgacggtgtctgg
gaggtgggcacacatcactcgtcctcgtgggggccgctcggacgtcgtcggcgcacgatc
accgctggtcaggtgatcctggcggccggcacgttcaacacccaacgactgctgcaccac
gcgaaactcggttcgctgccccggatctcggatgcgatgggcaggctcacgcggaccaac
tcggagtcgatcctgggtgcgatgggttcgcggatcgacccggagaacgactactcgcgc
ggtgtcgcgatcacctcgtcgttctatcccgagccgaacacgcacatcgagccggtgcga
tatggcaagggctccaacgcgatcgcgtacctgcagaccctgctcaccgacggggggagc
cggcgtgaccggttcggccagttcctgcggcaggtcgcccgcaacccgttcctgctggtg
cggttgctcgtggtgcggcagtggagcgagcggaccgtgatcgcgctcgtcatgcagaac
aacaacaattcgttgaccacgttcgtccgcaagcgcggaccgctgcggtatgtcaccagc
aagcagggtcacggcgagcccaacccgacgtggattcccaagggcaacgaggcaactcgc
cggatcgcggcgaaactgaacggcggcgtcgccggcgggacctggggtgacatcgtcaac
atgccgctgaccgcgcactatctcggcgggtgcgcgatctccgacgacccggacaacggc
gtcatcgacccctaccagcgcgtgtggaactacccgacgctgcacatcgccgacggtgcg
tcggtgtcggcgaacctcggtgtcaacccgtcgctgacgatctgtgcgcaggcggagcgg
gcggcggccctgtggccgaacaagggtgaacaggatcgtcgtccggcgcagggcgagccg
taccgccgcatcgagccgatcacgccgacgtcgccggtggtcccagccgacgcaccgggc
gctctgcggttgccgatcatcccgctcacaccggtcaccgcccagcggatctcgtag

DBGET integrated database retrieval system