KEGG   Gordonia sp. KTR9: KTR9_2043Help
Entry
KTR9_2043         CDS       T02216                                 

Definition
(GenBank) putative Fe-S-cluster redox enzyme
  KO
K06941  23S rRNA (adenine2503-C2)-methyltransferase [EC:2.1.1.192]
Organism
gor  Gordonia sp. KTR9
Brite
KEGG Orthology (KO) [BR:gor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gor03009]
    KTR9_2043
Enzymes [BR:gor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.192  23S rRNA (adenine2503-C2)-methyltransferase
     KTR9_2043
Ribosome biogenesis [BR:gor03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    KTR9_2043
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM Fer4_14
Motif
Other DBs
NCBI-ProteinID: AFR48680
UniProt: J9S6R9
Position
2324404..2325510
Genome map
AA seq 368 aa AA seqDB search
MTSLPLVFDAPRRGRPPTHFADLDAAGRVAALAELGLPKFRADQLARQYYARLNGNVDEM
TDLPAGSREGVRDKLFPQLLTPVRHISCDDDSTRKTLWRLHDGTLLESVLMRYTERNTLC
ISSQAGCGMACPFCATGQGGLDRNLSTAEIVDQVRAAARALRDGELGEPGRLSNVVFMGM
GEPLANYKRVVNAVRQITSPAPDGLGISARSVTVSTVGLAPSIRRLADEGLAVTLAVSLH
TPDDELRDTLVPVNNRWSVDEVLEAARYYADTTGRRVSIEYALIRDVNDQPWRADLLGQK
LHRALGSLVHVNLIPLNPTPGSEWDASPKPVEREFVRRVREQGVSCTVRDTRGQEIAAAC
GQLAAEER
NT seq 1107 nt NT seq  +upstreamnt  +downstreamnt
atgacctcattgccacttgtgttcgacgcgccccgacgcgggcgtccgccgacacacttc
gccgacctcgacgccgccggtcgcgtcgcggcgctggccgagctggggctgccgaagttc
cgggccgatcagctggcccgtcagtactacgcgcgtctcaacggcaacgtcgacgagatg
accgacctgcccgcaggctcccgcgaaggggtgcgggacaagctcttcccgcagctgttg
accccggtccggcatatctcctgcgacgacgactccacccgcaagacgctgtggcgtctg
cacgacggcaccctcctcgagagcgttctcatgcgctacaccgagcggaacaccctgtgt
atctcgagccaggccggatgcggcatggcctgcccgttctgcgcgaccggacagggcggg
ctcgatcgcaacctgtcgaccgccgagatcgtcgaccaggtccgtgctgcggctcgtgcg
ctgcgtgacggcgaactcggcgaacccgggcgcctgtcgaacgtcgtgttcatgggcatg
ggcgagccgctggccaactacaagcgcgtggtgaacgcagtccggcagatcacctcgccc
gcgccggacggtctcgggatctcggcacgctcggtgaccgtgtcgaccgtcggcctcgcg
ccgtcgatccgtcgtctcgccgacgagggcctcgcggtcaccctcgccgtctcgctccac
acgcccgacgacgagctgcgcgacaccctcgtcccggtgaacaaccgatggtcggtcgac
gaggtgctcgaggcggcccgctactacgccgacaccaccggacgacgcgtctcgatcgag
tacgccctcatccgggacgtcaacgaccagccctggcgagccgacctgctggggcagaaa
ctgcaccgtgccctcgggtcactcgtgcacgtgaacctcatcccgctgaatccgacgccg
ggctcggaatgggacgccagtcccaaaccggtcgaacgcgagttcgtccggcgtgtccgc
gagcagggagtctcgtgcaccgtccgcgacacgcgcggtcaggagatcgccgccgcctgc
ggacagctggccgccgaggagcgctga

DBGET integrated database retrieval system