KEGG   Gordonia sp. KTR9: KTR9_2059Help
Entry
KTR9_2059         CDS       T02216                                 

Definition
(GenBank) putative dehydrogenase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
gor  Gordonia sp. KTR9
Pathway
gor00020  Citrate cycle (TCA cycle)
gor00620  Pyruvate metabolism
gor01100  Metabolic pathways
gor01110  Biosynthesis of secondary metabolites
gor01120  Microbial metabolism in diverse environments
gor01130  Biosynthesis of antibiotics
gor01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gor00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KTR9_2059
   00620 Pyruvate metabolism
    KTR9_2059
Enzymes [BR:gor01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     KTR9_2059
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: AFR48696
UniProt: J9S231
Position
2343885..2345411
Genome map
AA seq 508 aa AA seqDB search
MSKTEITTDVALVGAGIMSATLGALLRQLQPDWSISLFEQLDAAAAESSDPWNNAGTGHS
ALCELNYTPKTADGDVNIDKALTINEQFQVSRQFWAHAVDSGILGDPSEFINPIPHVAFT
HGAEGQKYLRKRYDNLASQTLFEGMEFIDDPAEFSERLPLMSHGRDFADPVALNWFDQGT
DVDFGALTQQLLNYVAQGADIYFGHSVTNLSKQSDGSWIVKVRNGRTGQKLSVHAKFVFV
GAGGGALHLLQKSGIKEAKGFGGFPVSGEFFRCTNPDLVAEHHAKVYGQAAVGAPPMSVP
HLDTRVINHKPGLLFGPYAGWSPKFLKSGKITDLPASIKPGNLLPMMSIAPKEFGLLKYL
ISELAAGPADRVKTLSEFVPRALGADWELITAGQRVQVIRKTGVGGQLEFGTAVVAAGDG
TIAGLLGASPGASTAVPAMLSVLEQCFPEEYAGWTSKLSGIIPSFGQKLNGNRDLYRQVW
DWTNKSLQLTERNETPAETGRLAPATAG
NT seq 1527 nt NT seq  +upstreamnt  +downstreamnt
gtgtcgaaaacggagatcacgaccgacgtcgcgttggtgggtgcgggaatcatgagtgcc
acgctgggagcgctgctccggcagctccagcccgactggtcgatcagcctgttcgagcag
ctcgacgcggccgccgcggagagcagcgacccgtggaacaacgccggcaccggccattcg
gcgctgtgtgagctcaactacacgccgaagacggccgacggtgacgtcaacatcgacaag
gcgctcaccatcaacgagcagttccaggtgtcgcgccagttctgggcccacgcggtcgac
agcggcatcctcggtgacccgtcggagttcatcaacccgatcccgcacgtcgcgttcacc
cacggcgcggaggggcagaagtacctccgcaagcgctacgacaacctcgcctcgcagacc
ctgttcgagggcatggagttcatcgacgacccggccgagttcagcgagcggctgccgctg
atgtcccacggacgcgacttcgccgacccggtcgcactgaactggttcgaccagggcacc
gatgtcgacttcggcgcactgacccagcagctcctcaactacgtcgcgcagggcgccgac
atctacttcggccactcggtcaccaacctgtccaagcagtccgacggcagctggatcgtg
aaggtccgcaacgggcggaccggccagaagctgtccgtgcacgcgaagttcgtgttcgtc
ggcgccggcggtggtgcactgcacctgctgcagaagtcggggatcaaagaagccaagggg
ttcggcggattcccggtctccggtgagttcttccgctgcacgaatcccgatctcgtcgcc
gagcaccacgcgaaggtctacggacaggccgccgtcggtgcgccgccgatgtcggtgccc
cacctcgacacccgcgtcatcaaccacaagcccggcctgctgttcggtccgtacgccggc
tggtcgcccaaattcctcaagagcggcaagatcaccgatctgcccgcgtcgatcaagccg
ggcaacctgctcccgatgatgtcgatcgcgccgaaggagttcggcctgctcaagtacctc
atcagcgagctcgccgccggccccgccgaccgggtcaagacgctgtcggaattcgtcccc
cgcgcgctcggcgccgactgggagctcatcaccgccggacagcgcgtacaggtcatccgc
aagaccggcgtcggtgggcagctcgagttcggcaccgcggtcgtggcggccggtgacggc
acgatcgccggcctcctgggggcgtcgcccggcgcctcgaccgccgtcccggcgatgctc
tcggtgctcgagcagtgcttccccgaggagtacgcgggctggacgtcgaagctgtccggg
atcatcccgtccttcggccagaaactgaacggcaaccgggacctgtaccgccaggtctgg
gactggacgaacaagtcgctgcagctgaccgagcgcaacgagacccccgccgagaccggc
cggctcgcgcccgccaccgccggctga

DBGET integrated database retrieval system