KEGG   Gordonia sp. KTR9: KTR9_2625Help
Entry
KTR9_2625         CDS       T02216                                 

Definition
(GenBank) Exonuclease V gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
gor  Gordonia sp. KTR9
Pathway
gor03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gor00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    KTR9_2625
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gor03400]
    KTR9_2625
Enzymes [BR:gor01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     KTR9_2625
DNA repair and recombination proteins [BR:gor03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     KTR9_2625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: AFR49262
UniProt: J9RLR8
Position
complement(3000165..3003647)
Genome map
AA seq 1160 aa AA seqDB search
MLILHRAERTDTLADALADVLTHPLDDPMRPEIVSVPAAGVERWLAQHLARRLGTGAGGD
GIAANIDFTGPSRLADAIGAAVLGGTRLHTAASLTAPDDPWRATELTWPVLRVLDDRIDD
PALDVIARHIGAGDASSPRIGRRYATARHVAELFDRYGRSRPSLIADWAAGDDLDGAGRP
LRDDLAWQPAFWRAVREEIGRPHPAEDLAAVCDRLRADPAAGGLPERLSVFGPTRITESF
RQIAAAAAVHHDVHLFVPHPSPRLWDELGALVDRDALEGVPPRRGERELPELRNPLLAGL
SRDLQELQLRLAPIVDRDVHHPPRQPVVADSALHAVQSGIRDDLDPAPDVTDSSGDSGPV
GIAHGGLASSSAVADRSVEVHACHGPERQIEVLRDRLLHLFADDPELQPRDVLIMCPDVE
TFAPLIRGAFGQAGLPHPAFDLRVRLADRGIRHVNPILDVIVGVVELAAGRVTAGDVVDL
LGAPPVRTRFAMTDDDLDLIREWLAHSNVRWGLGVAERARYGLERFRQGTFDAGLDRISL
GVVAEESDDEWLGTALPLAGVESTGIDLVGRFDEFLSRLGRVLAELREAAPAHRWAETLI
DAVSSLTATEPVDDWQRAQAIRMLSEAFGDTRPVEPEEVLRLADVRDLLAALVAGRPTRS
NFRTGELTVCTMVPMRSVPHRVIVLLGVDAEVFPRVQRIDGDDVLGVDPLVGERNPRDED
RQCFLDAICAAQDALLVFYSGADPVSGRRIPPAVVVSELTDTLTGLTGTSVLRRHSLHGF
DARNFTPGGVPGIPGPFSHDASMLAGAEALREPSQRPVVAAHEVLPAPERTFDTEDIDLA
TLIDFHVDPIVAFVRQRLGARIPDDDRPHDDQLDVELEPLDKWGIGDRFLSRMLTGVSIA
DCEAAELRRGTLPPFAFGTRELRAISRAVTRLHGVVEPLRSGTPRTLDVLVRLPDGRRVH
GTVGDVFGDTGPAAVVRATYSKLKAKQQLSGWITLLAVAAAATQGNPEARPVESAVLVGR
AARGGGTSTVRLRRPEDPVSLLHDLVRLRDEGLRRPLPLPLEPACTFVENDGPGRRSTFS
LANARRTFDDKFGPANDPYVKLAFGGDVLADVEFDDLLDDPAPEQRTIGGVELAMTEGEP
LFAGLARTVWVPLNQHREGT
NT seq 3483 nt NT seq  +upstreamnt  +downstreamnt
atgctgatcctccaccgcgccgaacgcaccgacacgctggccgacgccctggccgacgtc
ctgacgcatccgctggacgatccgatgcgtccggagatcgtgtcggtccccgccgccggg
gtcgagcggtggctcgcccagcatctggcacggcggttggggaccggtgccggcggcgac
ggtatcgccgccaacatcgacttcaccgggccgtcccgtctggcggacgcgatcggcgcc
gcggtgctcggcggaacccgtctgcacaccgccgcctcgctcacggcgccggacgacccg
tggcgcgcgaccgagctgacgtggccggtgctgcgcgtcctcgacgaccggatcgacgat
cccgctctggacgtcatcgcgcggcacatcggagccggcgatgcctcctcgccccggatc
ggacgccgctacgccaccgcgcggcatgtggccgaactgttcgaccggtacgggcggtcg
cggccgtccctgatcgccgactgggccgccggtgacgacctcgacggcgccggtcgacca
ctgcgggatgacctcgcctggcagcccgcgttctggcgtgcggtccgcgaggagatcggc
cgaccgcatcccgcggaggatctcgccgccgtctgcgatcgcctccgcgccgaccccgcg
gccggcgggttgccggaacgactgtcggtgttcgggccgacgcggatcaccgagtcgttc
cgtcagatcgctgccgccgcggccgtccaccatgatgtccacctgttcgttccgcatccg
agtccgcgcctgtgggacgaactcggagccctggtcgaccgcgatgccctcgagggggtt
ccgccgaggcgcggggaacgcgagctccccgaactgcgaaacccgttgctggccggcctc
tcccgggatctgcaggaactgcagttgcggctcgccccgatcgtggatcgggacgtccac
catccgccgcggcagccggtggtcgcggattcggcgctacacgcggtccagtcggggatc
cgcgatgacctcgatcctgcgcccgacgtcaccgactcctccggtgattccggccccgtc
ggcatcgcgcacggtggcctcgcatcgtcgtcggcggtcgcggaccggtcggtcgaggtg
cacgcctgtcacggacccgagcgccagatcgaggtgctgcgggatcggttgttgcatctg
ttcgccgacgatcccgagctgcagccgcgcgacgtcctcatcatgtgtcccgatgtcgag
accttcgcgcccctgatccgtggtgcgttcggtcaggcgggactgccgcatccggccttc
gacctccgagttcggctggccgaccgcggaatccgtcacgtcaacccgatcctcgacgtg
atcgtcggggtcgtcgagctggccgcgggacgcgtgaccgccggtgatgtcgtcgacctc
ctcggggccccgccggtacgaacacggttcgcgatgaccgacgacgacctcgacctcatc
cgggaatggttggcgcacagcaatgtccgctggggtctgggcgtcgccgaacgggcccgg
tacggtctcgaacgcttccggcagggcaccttcgatgccggcctggatcgcatctccctc
ggcgtcgtcgccgaggagtccgacgatgaatggctcggcaccgcactcccgctggccggc
gtcgagagcaccgggatcgacctcgtcggccggttcgacgagttcctgtcccgcctcgga
cgggtgctggccgaactgcgggaagccgcgcccgcgcaccgctgggcggagacgctcatc
gatgccgtctcgtctctcacggcgaccgagcccgtcgacgattggcaacgcgcgcaggcc
atccggatgctgagtgaggccttcggcgacacccggccggtcgagccggaggaggtactg
cgcctggcagacgtgcgggacctgttggcggctctggtcgcgggccggccgacgcgctcg
aacttccgcaccggagaactcaccgtctgcacgatggtgcccatgcgctcggtgccgcat
cgggtgatcgtgctcctcggtgtggacgcggaggtcttcccgcgtgtgcagcgcatcgac
ggagacgacgtcctcggcgtcgatccgctggtgggggagcgtaacccgcgggacgaggac
cggcagtgtttcctcgacgcgatctgcgcggcgcaggacgcactcctggttttctacagc
ggtgccgatccggtgtcgggccggcggatcccgcccgccgtggtcgtcagcgaactcacg
gacaccctcaccggcctgaccggcaccagcgttctccgtcggcactctctgcacgggttc
gatgcgcggaacttcactcccggtggggtgccgggcattccgggaccgttcagccacgat
gcgtcgatgctcgccggcgccgaggcgttgcgcgagccgtcgcagcgtccggtggttgcc
gcacacgaggtactgcccgcgccggaacgcaccttcgacaccgaggacatcgacctcgcg
acgctcatcgatttccacgtggatccgatcgtcgcgttcgtccggcagagactcggtgcc
cgcattcccgacgacgaccggccgcacgacgaccagctcgacgtcgaactggaaccgctg
gacaagtggggaatcggcgatcggttcctgtcccggatgctgaccggggtgtcgatcgcg
gactgcgaagcggccgaactccggcgcggcaccctgccgccgttcgcgttcggtacccgc
gagctccgcgcgatctcgcgggcggtgacccgcttgcacggcgtcgtcgagccgttgcgg
tcggggactcccagaaccctcgacgtcctggtccgcctgcccgacggacgccgggtgcat
ggcacggtcggcgacgtgttcggcgacaccggaccggccgcggtggtacgggcgacctat
tccaaactcaaggccaaacagcaactcagtggctggatcacgctcctcgcggtcgccgcc
gcggcgactcagggcaaccccgaagcccgaccggtcgagtcggcggtcctggtcgggcgt
gccgcacggggcggtgggaccagcaccgtcaggctccggcgtcccgaggatccggtctcg
ctgctccacgacctcgtccgactgcgcgacgagggtctgcgtcgcccgctgccgctgccg
ttggaaccggcgtgcactttcgtcgagaacgacggtcccggccggcggagcaccttctcg
ctggccaatgcccgcaggaccttcgacgacaagttcggtcccgccaacgacccctacgtg
aagctggccttcggtggagacgtactggccgatgtcgagttcgacgacctcctcgacgac
cctgcacccgagcaacgaaccatcggcggtgtcgagttggccatgaccgagggagaaccg
ctgttcgccggactggctcgaaccgtgtgggtgccgctcaaccagcaccgggagggcaca
tga

DBGET integrated database retrieval system