KEGG   Gordonia sp. KTR9: KTR9_2693Help
Entry
KTR9_2693         CDS       T02216                                 

Definition
(GenBank) 16S rRNA uridine-516 pseudouridylate synthase-related pseudouridylate synthase
  KO
K06178  23S rRNA pseudouridine2605 synthase [EC:5.4.99.22]
Organism
gor  Gordonia sp. KTR9
Brite
KEGG Orthology (KO) [BR:gor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gor03009]
    KTR9_2693
Enzymes [BR:gor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.22  23S rRNA pseudouridine2605 synthase
     KTR9_2693
Ribosome biogenesis [BR:gor03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    KTR9_2693
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4 S4_2
Motif
Other DBs
NCBI-ProteinID: AFR49330
UniProt: J9S9P0
Position
complement(3073470..3074405)
Genome map
AA seq 311 aa AA seqDB search
MASAGRDGSPGNRRKGAPAQQPRTKKTHRKGSSKPNVEVGKIRLNNAKPARHQTPADDTH
GSGANYVEDGVRLQKVLAQAGVASRRGAEEMIAAGRVEVDGEIVTEQGMRINPDTAIIRV
DGARVIMDETRQYLAFNKPKGWQSTMSDDQGRPSVGDVIAERVMAGQRLFHVGRLDADTE
GLLLLTNDGELAHRLMHPSFEVPKTYLATLKGEVPRGIARRMREGVDLDDGPVTVDKFTV
IEVHEGQSLVRITLHEGRNRVVRRMMDEVGYPVVKLVRTHVGSVALGEQRPGSLRVLGSD
EVGGLYKAVGL
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atggcatccgctggccgagatggctcaccgggaaaccgccgcaagggcgcgcccgcacaa
cagccgcgaaccaagaagacccaccgcaaggggtcgtcgaagccgaacgtcgaagtgggc
aagatccggctgaacaacgcaaagccggcgcgccaccagacgcccgccgatgacactcac
ggctccggcgccaactacgtcgaggacggcgttcggttgcagaaggtgctcgcccaggcc
ggcgtggcgtcacgacgcggcgccgaggagatgatcgcggccggtcgtgtcgaggtcgac
ggcgagatcgtcaccgagcaaggtatgcgtatcaaccccgacaccgcgatcatccgcgtg
gacggcgcccgcgtgatcatggacgagacccgtcagtacctggcgttcaacaagcccaag
ggctggcagtcgacgatgtcggacgaccagggccgtcccagcgtcggtgacgtgatcgcc
gagcgggtcatggcgggccagcgactgttccacgtcggtcgcctcgacgccgacaccgag
ggtctgctgctgctgaccaacgacggcgaactcgcgcaccggttgatgcacccgtccttc
gaggtgcccaagacctacctcgcaacactcaagggcgaggtcccgcgcgggatcgcgcga
cgcatgcgcgagggcgtcgacctcgacgacggcccggtgacggtcgacaagttcaccgtg
atcgaggtccacgaggggcagtcgctggtgcggatcactctgcacgagggccgcaatcgc
gtggtgcgtcgcatgatggacgaggtcggttacccggtcgtcaaactggttcgcacacat
gtcggttcggtggcactgggcgagcagcgcccgggcagcctgcgcgtcctgggcagcgac
gaggtcggtggcctgtacaaggcggtcggcctgtga

DBGET integrated database retrieval system