KEGG   Gordonia sp. KTR9: KTR9_2989Help
Entry
KTR9_2989         CDS       T02216                                 

Definition
(GenBank) Pseudouridylate synthase, 23S RNA-specific
  KO
K06180  23S rRNA pseudouridine1911/1915/1917 synthase [EC:5.4.99.23]
Organism
gor  Gordonia sp. KTR9
Brite
KEGG Orthology (KO) [BR:gor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gor03009]
    KTR9_2989
Enzymes [BR:gor01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.23  23S rRNA pseudouridine1911/1915/1917 synthase
     KTR9_2989
Ribosome biogenesis [BR:gor03009]
 Prokaryotic type
  rRNA modification factors
   23S rRNA modification factors
    KTR9_2989
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2 S4
Motif
Other DBs
NCBI-ProteinID: AFR49624
UniProt: J9SIR4
Position
complement(3452861..3453787)
Genome map
AA seq 308 aa AA seqDB search
MRESRFLPVPDGLDGMRVDAGVSRMLGLSRTVVATLAEDGDVIVDGVAVGKSHKLAAGTM
LHVTLPEPAEPLRIEPTPVEDLEVIYHDSDIVVVDKPVGVAAHPSVGWSGPTVIGALAAA
GFRISTSGAHERQGIVHRLDVGTSGVMVVAVSERAYTLLKRAFKQRTVDKGYHALVQGHL
DPPSGTIDAPIGRHRGNDWKFAVTANGKPSVTHYDTLEMFASASLLDVHLETGRTHQIRV
HFSALHHPCCGDPTYGADPVLAKKLGLERQWLHARSLGFAHPADGRQVEFTSSYPEDLQH
ALDVLRST
NT seq 927 nt NT seq  +upstreamnt  +downstreamnt
atgcgtgaatcgcgtttcctaccggtgcccgacggtctcgacgggatgcgggtggacgcc
ggcgtctcgcggatgctcgggctgtcgcgcaccgtcgtcgccaccctcgccgaggacggc
gacgtgatcgtcgacggcgtggcggtggggaagtcccacaagctcgccgcgggcacgatg
ctgcacgtgactctgcccgagccggcggaaccgctgcgtatcgagccgacgccggtggag
gacctcgaggtcatctaccacgactccgacatcgtcgtcgtcgacaagccggtgggggtg
gccgctcatccgtccgtcggctggagcgggccgacggtcatcggggcgctcgcggcagcg
ggtttccggatctcgacctcgggcgcccacgaacgccagggcatcgtccaccgtctggac
gtcggtacctcgggagtcatggtcgtcgcggtgtccgagcgggcgtacacgctgctcaag
cgtgcgttcaaacagcggaccgtggacaagggctaccacgccctggtccaggggcacctc
gacccgccgtcggggacgatcgacgccccgatcggccgtcaccgcggcaacgactggaag
ttcgcggtcaccgcgaacggcaaaccgagcgtcacccactacgacaccctggagatgttc
gcgtcggcgtcgctgctcgacgtgcacctcgaaacgggtcgtacgcaccagatccgggtt
cacttctcggccctgcatcatccgtgttgcggtgatccgacgtacggtgccgatccggtc
ctggccaagaagctgggtctcgaacgtcagtggctgcacgcgcggtcgctggggttcgcc
catcccgccgacggccggcaggtggagttcacctcgtcgtacccggaggacctgcagcac
gcgctcgacgtcctgcggtcgacctga

DBGET integrated database retrieval system