KEGG   Gordonia sp. KTR9: KTR9_3347Help
Entry
KTR9_3347         CDS       T02216                                 

Definition
(GenBank) SAM-dependent methyltransferase
  KO
K00563  23S rRNA (guanine745-N1)-methyltransferase [EC:2.1.1.187]
Organism
gor  Gordonia sp. KTR9
Brite
KEGG Orthology (KO) [BR:gor00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03009 Ribosome biogenesis [BR:gor03009]
    KTR9_3347
Enzymes [BR:gor01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.187  23S rRNA (guanine745-N1)-methyltransferase
     KTR9_3347
Ribosome biogenesis [BR:gor03009]
 Prokaryotic Type
  rRNA modification factors
   23S rRNA modification factors
    KTR9_3347
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_25 Methyltransf_11 Trm112p
Motif
Other DBs
NCBI-ProteinID: AFR49982
UniProt: J9RP32
Position
complement(3841532..3842503)
Genome map
AA seq 323 aa AA seqDB search
MPHEGSSHEARADTPTPHRAHGLNSTVEILRCPVCAGPLSVDATSLRCPAAHSFDIARQG
YVSLLDGRSGALRADTAAMVAARARVHDAGFFGAVVDSVARRAAEFASGLARPVILDAGA
GGGHYLRAAVDAGAAAGGVERSSVAGIGIDLSKYCARAIARGPHSLAAIVADVWRGLPVV
DDAVSVVLSVFAPRNAPEFARVLAPDGALIIVSPGPDHLAELIEPMGMLRVDSAKSARLH
AALDDGFELVDESPLRYTASVDAATVGDLVAMGPSAFHSEEADIRSRADAFAGTGRVPVT
VSVVMTTCRPARGRHPGQRRTDS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgccccacgagggcagttcccatgaggcccgggcggacacaccgacaccgcaccgggcg
catggcctcaactcgaccgtcgagatcctacgatgcccggtgtgcgccgggcccctttcg
gtcgacgccacctcgttgcgttgtcccgccgctcactcattcgacatcgcgcggcagggc
tatgtctcactgctcgacggccggtcgggcgcgttgcgcgccgacaccgcggccatggtc
gccgcgcgggcgcgggtgcatgacgccggtttcttcggcgccgtggtggattccgtcgcc
cgacgcgccgccgagttcgcgagcggactcgccaggcccgtgattctcgacgcgggcgcc
ggtggcggacactatcttcgcgccgcggtcgacgcgggcgcagcggcgggcggtgtcgaa
cgctcctccgtcgccgggatcggcatcgacctgtccaagtactgcgcgcgggccatcgcc
cgcggcccgcactcactcgcggcgatcgtcgccgacgtctggcgaggactgccggttgtc
gatgacgctgtctcggtggtgctctcggtgttcgcgccccggaacgcccccgagttcgcc
cgggtgctcgcgcccgatggcgcactgatcatcgtgagtccgggacccgaccacctcgcc
gagctcatcgaaccgatggggatgctgcgggtggactccgcgaaatccgcacgtctccac
gccgcactcgacgacggtttcgagctggtcgacgaatcacccctgcggtacaccgcgagc
gtcgacgccgctaccgtcggtgacctggtcgccatggggccctcggcatttcactccgag
gaggccgacatccgctcgcgggcagatgccttcgcggggacgggacgcgtgccggtgacg
gtgtcggtcgtgatgaccacctgccggccggcccgcgggcgacaccccggtcagcgccgg
acggactcgtag

DBGET integrated database retrieval system