KEGG   Gemella sp. oral taxon 928: AXE85_00165Help
Entry
AXE85_00165       CDS       T04256                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00071  Fatty acid degradation
got00072  Synthesis and degradation of ketone bodies
got00280  Valine, leucine and isoleucine degradation
got00362  Benzoate degradation
got00620  Pyruvate metabolism
got00630  Glyoxylate and dicarboxylate metabolism
got00640  Propanoate metabolism
got00650  Butanoate metabolism
got00900  Terpenoid backbone biosynthesis
got01100  Metabolic pathways
got01110  Biosynthesis of secondary metabolites
got01120  Microbial metabolism in diverse environments
got01130  Biosynthesis of antibiotics
got01200  Carbon metabolism
got01212  Fatty acid metabolism
got02020  Two-component system
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    AXE85_00165
   00630 Glyoxylate and dicarboxylate metabolism
    AXE85_00165
   00640 Propanoate metabolism
    AXE85_00165
   00650 Butanoate metabolism
    AXE85_00165
  09103 Lipid metabolism
   00071 Fatty acid degradation
    AXE85_00165
   00072 Synthesis and degradation of ketone bodies
    AXE85_00165
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    AXE85_00165
   00310 Lysine degradation
    AXE85_00165
   00380 Tryptophan metabolism
    AXE85_00165
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    AXE85_00165
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    AXE85_00165
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    AXE85_00165
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:got04147]
    AXE85_00165
Enzymes [BR:got01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     AXE85_00165
Exosome [BR:got04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AXE85_00165
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AME08715
UniProt: A0A0X8KKD6
Position
complement(46077..47255)
Genome map
AA seq 392 aa AA seqDB search
MTRVAIVSAFRSAIGAFGGSLKDIDVAELGAKVVKYSLDDINLEYNLVDEVIFGNVLQGG
LGQNIARQISVKAGLSKQTPAFVVNKVCGSGLKSVLLGTQSILLGDNDIVVCGGLEVMSG
APYYTKGIRFGKKLGSFELEDSIISDGLTDAFENYHMGITAENIAEKFNISRKEQDFFAF
DSQKKAQRAIETGKFKKEIVPIKVKIGKEECIFDTDEFPRFNSTMEGLGKLRPAFKKEGT
VTAGNSSGINDGAAAVILMNEKRAIELGIEPLVFIEGYATSGLDNKIMGLGPVPAVNKVL
TKLNISKEEVDLFELNEAFAAQSLAVINELGVDSEKVNINGGAIALGHPIGASGTRILVS
LVHELIHENKKRGLCSLCIGGGQGIALVIHRN
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
atgactagagttgctattgtttccgcttttcgttcggcaatcggagcgtttggcggaagt
ttaaaagatattgatgtagcagaacttggggcaaaagttgtgaaatattcgttggacgac
ataaacttagaatataatttggtggatgaggtaatttttggtaatgtccttcaaggtggt
cttgggcaaaatatagctagacaaatttctgttaaagcaggtctgtctaaacaaactccg
gcgtttgtagttaacaaagtttgcggttccgggttaaagagtgttttactcgggacacag
tctattctgcttggagataatgacatagttgtttgtggtggactagaggttatgagtggt
gcaccatactatacgaaaggtattcgctttgggaaaaaattaggttcttttgaattggaa
gacagtataatttctgacggtttaacagatgctttcgagaattatcatatgggaattacc
gccgaaaatattgcagaaaaatttaatatttcgagaaaagagcaggatttttttgcgttt
gatagccagaaaaaagctcaaagggcgatagaaaccgggaaatttaagaaagaaattgtc
cccattaaagtaaaaataggaaaggaagaatgtatttttgataccgatgaatttccgagg
tttaattctactatggaggggctgggaaaacttcgccccgcttttaaaaaagaagggact
gtgacggcagggaattcttcaggaattaatgatggagcggcggcggttattttaatgaac
gagaaaagagcaatagaattgggaattgaaccgttggtgtttatagaaggatatgctact
tccggtttggataataaaataatgggtttaggccctgttccggctgttaataaagtattg
acaaagttaaacatttcaaaagaagaggttgatttattcgagttgaatgaggcgtttgca
gcacagtcgctggcagttattaacgaattaggtgtggacagtgaaaaagtaaacattaat
ggaggggctatagcccttgggcatccgataggagcgagcggaacaagaattttagtgagc
cttgttcatgaacttattcatgaaaataagaaacgaggtctttgttcactttgtataggt
ggaggacagggtatagcacttgttatacatagaaattaa

DBGET integrated database retrieval system