KEGG   Gemella sp. oral taxon 928: AXE85_04535Help
Entry
AXE85_04535       CDS       T04256                                 

Definition
(GenBank) adenylosuccinate synthetase
  KO
K01939  adenylosuccinate synthase [EC:6.3.4.4]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00230  Purine metabolism
got00250  Alanine, aspartate and glutamate metabolism
got01100  Metabolic pathways
Module
got_M00049  Adenine ribonucleotide biosynthesis, IMP => ADP,ATP
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    AXE85_04535
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AXE85_04535
Enzymes [BR:got01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.4  adenylosuccinate synthase
     AXE85_04535
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Adenylsucc_synt
Motif
Other DBs
NCBI-ProteinID: AME09461
UniProt: A0A109WH39
Position
1003131..1004417
Genome map
AA seq 428 aa AA seqDB search
MSIIVVVGSQWGDEGKGKITDFLAERADVIARYQGGNNAGHTIKFDGKTYKLQLIPSGIF
NDEKLSVIGNGLVVDPKWICGEINRLKESGVTCNGLRISNRAHVVLPYHLKLDEVEEARR
GDNKIGTTKKGIGPCYVDKYKRCGVRIADLLDKELFKKKLEQNLKEKNEVFEKIYGVDGF
TVEEIFNEYFEYGKQLAQYVTDTSKVLGDAQKERKNILFEGAQGVMLDIDHGTYPYVTSS
NPSAGGITIGNGFVPTNGFKVLGICKAYTSRVGDGPFPTELFDEVGDTIREVGHEYGTVT
KRPRRIGWFDTVVMRHSARVSGMTNLSVNCLDVLSGLKEIKICTAYDYKGEILTEYPANE
NIIKDCKPIYETLSGFNEDITGISSLEELPTNARKYLEKIEELVGVKISVFSTGPDRTQT
HLLEDLWK
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgtcaataattgtagtagtaggttcacaatggggtgatgaagggaaaggtaaaatcacc
gattttttagcagagcgtgctgatgttatagcacgttatcaaggtggtaacaatgcagga
catacaattaagttcgacggtaaaacttataaactacaacttattccatccggtattttt
aatgatgagaaattatctgttataggtaatggtttagtagttgatccgaaatggatttgc
ggtgaaattaaccgtctaaaagaaagtggtgtaacatgtaacggtttaaggatttctaac
agagcacatgtagtattgccatatcacttgaaacttgatgaagtagaagaagcaagacgt
ggggacaacaaaataggtactactaaaaaaggtatcgggccatgttatgtagataagtat
aaacgttgtggagtacgtattgctgatttattagataaagaattatttaagaaaaaatta
gaacagaatctgaaagaaaaaaatgaagtatttgaaaaaatttacggtgttgatggtttt
acagttgaagaaatttttaacgaatattttgaatacggaaaacagttagcacaatatgtt
accgatacatcaaaagtgttaggagatgctcagaaagaaagaaaaaatattttatttgaa
ggagcacaaggggtaatgcttgatattgaccatgggacatatccttatgttacatcatca
aatccaagtgccggcggaattactataggtaacggttttgttccgacaaacggttttaaa
gtccttggcatttgtaaagcatacacttctcgtgtaggtgacggaccatttccaacagaa
ttatttgatgaagttggggatacaattcgtgaagtgggacatgaatatggaacggtaaca
aaacgtccacgtcgtataggttggtttgacactgttgtaatgcgtcattcagcacgtgtg
tcaggtatgacaaacttatcggtcaactgccttgatgtattgtcaggtcttaaagaaata
aaaatctgtacagcttatgactataagggagaaattttaacagagtatcctgcaaatgaa
aatattataaaagattgcaaaccaatttacgaaacattatcaggttttaacgaagatatt
accggtatatcatcattagaagaactacctaccaatgcaagaaaatatttagaaaaaatt
gaggaattggtgggtgtaaaaatttccgtattttcaaccggaccagatagaacacaaacg
cacttgttagaagatttgtggaaataa

DBGET integrated database retrieval system