KEGG   Gemella sp. oral taxon 928: AXE85_07275Help
Entry
AXE85_07275       CDS       T04256                                 

Definition
(GenBank) haloacid dehalogenase
  KO
K01560  2-haloacid dehalogenase [EC:3.8.1.2]
Organism
got  Gemella sp. oral taxon 928
Pathway
got00361  Chlorocyclohexane and chlorobenzene degradation
got00625  Chloroalkane and chloroalkene degradation
got01100  Metabolic pathways
got01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:got00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    AXE85_07275
   00361 Chlorocyclohexane and chlorobenzene degradation
    AXE85_07275
Enzymes [BR:got01000]
 3. Hydrolases
  3.8  Acting on halide bonds
   3.8.1  In carbon-halide compounds
    3.8.1.2  (S)-2-haloacid dehalogenase
     AXE85_07275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HAD_2 Hydrolase Hydrolase_like PGP_phosphatase Hydrolase_6 HAD
Motif
Other DBs
NCBI-ProteinID: AME09956
UniProt: A0A109WHF4
Position
complement(1568357..1569040)
Genome map
AA seq 227 aa AA seqDB search
MNLTQYKYLLFDLDDTLLDFKKAERRAFKKLLLNHNIEYSDDLFEKYITINKSLWRKLEL
GELSSKDVTKGRFKRFFSLLNKEVNDEKYDKEYRIYLAEGNQVFKGVPELLKKLAQTHKL
YIATNGVAATQRTRFKNNKLDEYFDYIFISEELGYKKPDKEFFEKVFEIIGSKNKSEVLM
IGDNLVSDILGGNNFGIDTCWINAEDIENITNIIPTYKIRSVMELIR
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgaatttaacgcagtataagtatttattatttgatttagatgatacattattagatttt
aaaaaagcggaaagaagagcatttaaaaaattattgttaaaccataatatagaatatagt
gatgatttatttgaaaaatatattacaataaataaatcattgtggagaaaacttgaatta
ggagagcttagcagtaaagatgtaactaaggggaggtttaaacgtttttttagtttatta
aataaagaagttaatgatgagaagtatgataaggagtatagaatttatctggcagaaggt
aaccaagtatttaaaggagtaccggaacttttaaaaaaattagcacaaactcataaactt
tatatcgctactaacggcgtagcggcaactcaacgcacccgatttaaaaataataaacta
gatgaatattttgattatatatttatttcagaagaattagggtataaaaaacctgataaa
gaattttttgaaaaagtatttgaaataattggaagtaaaaataaaagtgaagtattgatg
ataggagataatctggtatctgacatactaggtgggaataattttggaatagatacctgt
tggataaacgcagaagatatagagaacatcacaaatataattccgacttataaaataaga
agtgtaatggagttaataagataa

DBGET integrated database retrieval system