KEGG   Gluconobacter oxydans 621H: GOX0145Help
Entry
GOX0145           CDS       T00230                                 

Definition
(GenBank) Glucose-6-phosphate 1-dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00030  Pentose phosphate pathway
gox00480  Glutathione metabolism
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01200  Carbon metabolism
Module
gox_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
gox_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:gox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GOX0145
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    GOX0145
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gox04147]
    GOX0145
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     GOX0145
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     GOX0145
Exosome [BR:gox04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   GOX0145
  Exosomal proteins of colorectal cancer cells
   GOX0145
  Exosomal proteins of bladder cancer cells
   GOX0145
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N
Motif
Other DBs
NCBI-ProteinID: AAW59938
UniProt: Q5FUK8
Position
159594..161063
Genome map
AA seq 489 aa AA seqDB search
MEHFQQVEPFDYVIFGATGDLTMRKLLPALYNRLRMGQIPDDACIIGAARTELDREAYVA
RARDALERFLPSDILGPGLVERFLARLDYVTLDSSREGPQWDALKSLLAKAQPDRVRVYY
FATAPQLYGSICENLNRYELITPTSRVVLEKPIGTNMATATAINDGVGQYFPEKQIYRID
HYLGKETVQNVLALRFANPLMNAAWSGEHIESVQITAVETVGVEGRAAYYDTSGALRDMI
QNHLLQVLCLVAMEAPDSLEADAVRNAKLAVLNALRPITDATAATETVRAQYTAGVVDGE
NVPGYLEELGKPSATETYAAIRAWVDTPRWKNVPFYIRTAKRSGKKVSEIVVTFRPAATT
MFGATPASNRLVLRIQPNEGVDLRLNVKNPALDVFNLRTADLDTSIRMEGGLPFPDSYER
LLLDAVRGDPVLFIRRDEVEAAWRWVEPILEAWKHDKAPMQTYSAGSYGPEQATQLLASH
GDTWHEASE
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
atggaacatttccagcaggtcgagcctttcgactatgtcatcttcggtgccactggcgat
ctcacgatgcgcaagctgctgcccgcgctctacaaccgccttcggatgggccagattccg
gatgatgcgtgcatcatcggagccgcccgtacggagctggaccgggaggcctatgtcgcg
cgggcccgagacgcccttgagcggtttcttccctcagacatcctgggcccggggctggtc
gagcgtttcctcgcccgtctcgattacgtgacgctggacagcagccgcgagggcccgcag
tgggacgccctgaagtccctgctggccaaggcacagcctgaccgggtgcgcgtctattat
ttcgcaaccgcaccgcagctttacggcagcatctgcgagaacctgaaccgctacgagctg
atcacccccacgtcgcgggttgttctcgaaaagccgatcggtacgaacatggccaccgcc
accgccatcaatgacggggtcggccagtattttccggaaaagcagatctaccggatcgat
cattatctcgggaaagagacggtccagaacgttctcgccctgcgttttgcaaacccgctc
atgaacgctgcctggtccggcgagcatatcgagagcgtgcagatcacggcggtcgagacc
gtgggcgtcgaaggtcgtgcggcctattacgacacgtctggcgcgcttcgcgacatgatc
cagaaccacctgctccaggtactgtgtctggttgcgatggaagcccccgattcccttgag
gccgatgccgtccgcaacgccaaactggccgtcctgaacgccctgcgccccatcacggat
gccacagccgccaccgagacggtgcgcgcgcagtacacggcaggcgtggtcgatggcgag
aatgttccgggttatcttgaagagctcggcaagcccagcgcgacggaaacctatgccgca
atccgcgcctgggtggacacgccgcgctggaagaacgtgccgttctacatccgcacggcc
aagcggtccggcaagaaggtcagcgagatcgtcgtgacgttccgcccggctgcgaccacc
atgttcggcgccaccccggccagcaacaggctggtcctgcgcatccagcccaacgaaggc
gtggacctgcgtctgaacgtcaagaaccctgcgctggatgtcttcaacctgcggacggcg
gatcttgatacctccatccgcatggaaggcggcctgcccttcccggattcctatgagcgg
cttcttctggatgccgtgcggggtgatccggtactgttcatccgccgcgacgaggtcgag
gccgcatggcgctgggtcgagcccatccttgaggcctggaaacatgacaaggcgcccatg
cagacctacagtgcgggttcctatgggccggaacaggcaacacaactgctcgccagccat
ggcgacacctggcatgaagcgtcggagtaa

DBGET integrated database retrieval system