KEGG   Gluconobacter oxydans 621H: GOX0282Help
Entry
GOX0282           CDS       T00230                                 

Definition
(GenBank) Phosphatidylserine decarboxylase
  KO
K01613  phosphatidylserine decarboxylase [EC:4.1.1.65]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00564  Glycerophospholipid metabolism
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
Module
gox_M00093  Phosphatidylethanolamine (PE) biosynthesis, PA => PS => PE
Brite
KEGG Orthology (KO) [BR:gox00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    GOX0282
Enzymes [BR:gox01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.65  phosphatidylserine decarboxylase
     GOX0282
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PS_Dcarbxylase DUF2118
Motif
Other DBs
NCBI-ProteinID: AAW60065
UniProt: Q5FU81
Position
298085..298762
Genome map
AA seq 225 aa AA seqDB search
MSLIQSFKLVLSPPHRAATPFLLAGSLVGLLGRATPWRPTRLLGNAGIAFTAFCLYFFRD
PKRVPPPRADLVLASADGRVTSVALVTPPAALEMGHTPVWRVSTFLSVLNVHINRMPAAG
EVTKIAYHAGKFLNASFDKASEHNERNELRLTLPDGRNIGVVQIAGLIARRILCFVEEGD
RVEAGERFGLIRFGSRTDVYLPPGVEPLVVEGQTMVGGETVLAKL
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atgtcgctgatccagtccttcaagcttgtcctgtcgccgccgcatcgcgccgcgactccc
ttcctcctcgcgggttcgctcgtcgggctgctcggacgggccacgccctggcgtcccacg
cgcctgctgggcaatgccggcatcgcctttacggcgttctgcctctacttcttccgcgac
cccaagcgcgtcccgccgccgcgcgccgatctggttctggcctccgctgatggccgcgtg
acctcggtcgcgctcgtcaccccacctgccgctctggaaatgggccacaccccggtctgg
cgcgtctcgacgttcctgtccgtgctgaacgtccatatcaaccgcatgccagcggccggt
gaagtgacgaagatcgcctatcacgccggcaagttcctcaatgccagcttcgacaaggcc
tccgagcataacgagcgcaacgaactgcgcctgacgctgccggacggtcgcaacatcggc
gttgtccagatcgccgggctgatcgcacgccgcatcctgtgcttcgtcgaagaaggtgac
cgcgtggaagccggcgagcgtttcggtctgatccgcttcggctcccgcaccgatgtctac
ctgccgcccggcgttgaacccctggttgtggaagggcagaccatggttggtggcgaaact
gtcctggcgaagctctga

DBGET integrated database retrieval system