KEGG   Gluconobacter oxydans 621H: GOX0417Help
Entry
GOX0417           CDS       T00230                                 

Definition
(GenBank) Putative 2-hydroxyacid dehydrogenase
  KO
K22229  2-ketogluconate reductase [EC:1.1.1.215]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00030  Pentose phosphate pathway
gox01100  Metabolic pathways
gox01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GOX0417
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.215  gluconate 2-dehydrogenase
     GOX0417
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 F420_oxidored XdhC_C Gp_dh_N
Motif
Other DBs
NCBI-ProteinID: AAW60200
UniProt: Q5FTU6
Position
441327..442259
Genome map
AA seq 310 aa AA seqDB search
MSSKPDILTIDPLVPVMKERLEKSFTLHPYTSLENLKNIAPAIRGITTGGGSGVPSEIMD
ALPNLEVISVNGVGTDRINLDEARRRNIGVAITQNTLTDDVADMAVALMMAVMRSIVTND
AFVRAGKWPSATAPLGRSLTRKKVGIAGFGHIGQAIAKRVSAFGMEVAYFNSHARPESTC
HFEPDLKALATWCDVLILAVSGGPRSANMIDRDTLDALGKDGFLVNIARGTVVDEAALLS
ALQEKRIAGAGLDVFQNEPNINPAFLSLPNTVLQAHQASATVETRTTMANLVVDNLIAYF
TDKTLLTPVI
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgtcatccaaacctgacattctgacgattgaccccctcgtgccggtcatgaaggaaagg
ctagagaaatcgtttacactccacccctacacctcactggaaaacctgaagaacattgct
cctgccatccgcgggatcacaacaggtggcgggtccggggttccttctgaaatcatggac
gccctgcccaatcttgaagtcatttccgtcaacggtgtggggacggaccgcatcaatctg
gatgaagcaagacgccgcaacatcggggtcgcaatcacccagaacaccctgacggacgac
gtggccgacatggccgtcgcgctgatgatggcagtgatgcggagcatcgtaacgaatgat
gccttcgtccgtgctggaaaatggccgtccgccacggctcccctcggacgaagcctgacc
cggaaaaaagtgggcatcgcaggatttggacatattggccaggcgattgccaaacgcgtc
tcggcgttcggtatggaggtggcctacttcaactcacatgcccgacctgaaagcacctgc
catttcgagcccgatctgaaggcgctggcaacctggtgcgacgtcctgatcctggcggtc
tcaggcggtccacgatccgccaacatgatcgacagagacaccctggatgctctgggcaaa
gacggtttcctggtcaatatcgcccgaggaacagtggtggacgaggccgcacttctgagc
gccttgcaggaaaaacgcatcgctggcgccggactggacgttttccagaacgagcccaat
atcaatccggcttttctaagcctgccaaacacagttctgcaggcccatcaggcgtcggcc
acagtcgaaaccagaacgaccatggctaatctggtcgtagacaacctgattgcctatttc
accgataaaaccctgctgacacccgtcatctaa

DBGET integrated database retrieval system