KEGG   Gluconobacter oxydans 621H: GOX1190Help
Entry
GOX1190           CDS       T00230                                 

Definition
(GenBank) Glucose-1-phosphatase
  KO
K01093  4-phytase / acid phosphatase [EC:3.1.3.26 3.1.3.2]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00562  Inositol phosphate metabolism
gox00740  Riboflavin metabolism
gox01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    GOX1190
  09108 Metabolism of cofactors and vitamins
   00740 Riboflavin metabolism
    GOX1190
Enzymes [BR:gox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     GOX1190
    3.1.3.26  4-phytase
     GOX1190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-ProteinID: AAW60951
UniProt: Q5FRP5
Position
1302317..1303345
Genome map
AA seq 342 aa AA seqDB search
MAAMEWGSRDLTPHGALGLTALGTFDRVWMAEAGLMPAKACPSAGAVAVRANSSARTIAS
AEAFVRGFMPGCSMTVMHKPPGQPDVLFSPLDADPARFDMSAIIPQLPDADRIFRAKGEA
LKLLGRVLDCGPASCGFLSAPAHVGVDATGHQLVLTGPVAQASSLSEALMLSYLDGKPLV
QTPSGVLDVGDLGTLSALHAGMLEAVVRPRALAEPLSREMRARLLQDLRDEGGPAFRLYM
GHDDTIGPLQTMLGLHFRVPGYAEDEIPIGSALGFAVYGNGTGERRIRVFIQSQTPQALR
DLDGKALPVVLYPQVPGCTQPGGLCAPEVLAQDFSEVRRAER
NT seq 1029 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaatggagtggggctccagggatctgacgcctcatggggcgctggggctgacg
gcgcttggaacatttgaccgggtgtggatggcggaagcggggctgatgccggcgaaagcc
tgtccgtccgcaggcgctgtggcggtccgtgccaattcctccgcgcggactatcgccagt
gctgaggcatttgtgcgtggcttcatgccgggctgttcaatgacggtcatgcacaagccg
cctggtcagccggatgttcttttttctccgctggatgctgatccggcgcgttttgatatg
tctgcgattattccgcaactgcctgatgcggatcgcattttccgtgcgaaaggtgaggct
ctcaaactgctggggcgtgtgctggattgtggtccggcatcctgtgggtttctgagcgcg
cctgcgcatgttggtgtggatgcgacggggcaccagcttgttcttacggggccggtcgcg
caggcgtcttccctgtccgaagcactcatgctgtcctatctcgatggaaagccgctggtt
cagacaccgtcaggtgttctggatgtgggcgacctcgggaccttaagcgccctgcacgct
ggcatgctggaagcggtggtgcgtccccgcgctctggccgaaccgctctctcgcgagatg
agggcgcggctgcttcaggatctccgggatgagggtgggcctgcattcaggctttatatg
gggcatgacgacacgatcggtcccctgcagaccatgctgggtcttcattttcgtgttccc
ggctatgccgaggatgagattcccatcggatctgccctgggatttgcggtgtatggaaat
ggaaccggggagcgccgtatccgtgtcttcatccagtcccagactccgcaggctctgcgt
gatctggatgggaaggcgctgcctgtcgtgctctatcctcaggttccgggctgtacgcaa
cctggcggattgtgcgctccggaggttctggcgcaggatttttctgaagtgcggcgtgcg
gagcgctga

DBGET integrated database retrieval system