KEGG   Gluconobacter oxydans 621H: GOX1516Help
Entry
GOX1516           CDS       T00230                                 

Definition
(GenBank) Fructose 1,6-bisphosphatase GlpX
  KO
K11532  fructose-1,6-bisphosphatase II / sedoheptulose-1,7-bisphosphatase [EC:3.1.3.11 3.1.3.37]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00010  Glycolysis / Gluconeogenesis
gox00030  Pentose phosphate pathway
gox00051  Fructose and mannose metabolism
gox00680  Methane metabolism
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01200  Carbon metabolism
Module
gox_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:gox00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX1516
   00030 Pentose phosphate pathway
    GOX1516
   00051 Fructose and mannose metabolism
    GOX1516
  09102 Energy metabolism
   00680 Methane metabolism
    GOX1516
Enzymes [BR:gox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.11  fructose-bisphosphatase
     GOX1516
    3.1.3.37  sedoheptulose-bisphosphatase
     GOX1516
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FBPase_glpX
Motif
Other DBs
NCBI-ProteinID: AAW61258
UniProt: Q5FQT8
Position
complement(1669292..1670293)
Genome map
AA seq 333 aa AA seqDB search
MIDPQNVLPYRVTDRNLALELVRVTEAAAIASAHWTGRGQKNEADGAAVQAMRAAFDTVA
IDGVVTIGEGEMDEAPMLYIGEKVGSGGPAMDIAVDPLEGTNLCAKSLPNALTVVALAER
GKFLHAPDIYMEKIVVGPDLPEGVVDLDASIGNNLRSLAKAKKRDVSDMVLCALDRERHE
EMIAHAREAGARVMLLSDGDVAAAIATCIDGSGVDLYAGSGGAPEGVLAAAAIRCMEGQM
QGRLLFEDDSQRERAREMANGLDPARKLFLHDMASGHVLFSATGVTSGPLLKGVERPSPT
RARTHSIVMRSKSGTVRYIESHHTFKPKAQAAS
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgaccctcagaatgttctcccgtaccgcgtcactgaccgtaatcttgctctcgag
ctcgtccgtgtaacggaagcggccgcaatcgcttccgcccactggaccggtcgcggccag
aagaacgaagccgatggcgccgctgtgcaggccatgcgcgctgcgttcgacaccgtcgcc
atcgatggcgtcgtcaccattggtgaaggcgagatggacgaagccccgatgctctacatc
ggcgagaaagtcggctccggtggcccggccatggacatcgcggtcgatccgctcgaaggc
accaatctctgcgccaagagcctgcccaacgccctgacggtcgtggccctcgccgagcgc
ggcaagttcctccacgcgcctgacatctacatggaaaagatcgtcgtcggccccgatctt
cccgaaggcgtggtggatctggatgcctcgatcggcaacaacctccgttcgctggccaag
gccaagaagcgcgatgtttcggacatggttctctgcgcacttgaccgcgaaagacatgaa
gagatgatcgcccatgcccgcgaagccggcgcgcgcgtcatgctcctgagcgacggtgac
gtggcggctgccatcgccacctgtatcgatggcagcggcgtggatctctatgccggttcg
ggtggcgctcccgaaggcgttctggccgccgcagccatccgctgcatggaaggccagatg
cagggccgcctcctgttcgaggatgacagccagcgtgagcgtgcccgtgaaatggccaac
ggcctcgatccggcccgcaagctcttcctgcacgacatggcctccggtcacgtcctgttc
tccgcaacaggcgtcacatccggcccgctgctgaaaggcgtggaacgtccgagcccgacc
cgggcccgcacacattccatcgtcatgcgttcaaaatccggcacggtgcgctatatagaa
agccaccataccttcaaaccgaaggcgcaagccgcttcctga

DBGET integrated database retrieval system