KEGG   Gluconobacter oxydans 621H: GOX1555Help
Entry
GOX1555           CDS       T00230                                 

Definition
(GenBank) Chemotaxis protein CheB
  KO
K03412  two-component system, chemotaxis family, protein-glutamate methylesterase/glutaminase [EC:3.1.1.61 3.5.1.44]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox02020  Two-component system
gox02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:gox00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    GOX1555
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    GOX1555
Enzymes [BR:gox01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     GOX1555
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.44  protein-glutamine glutaminase
     GOX1555
Two-component system [BR:gox02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   GOX1555
Bacterial motility proteins [BR:gox02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    GOX1555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest Response_reg
Motif
Other DBs
NCBI-ProteinID: AAW61296
UniProt: Q5FQQ0
Position
1701723..1702778
Genome map
AA seq 351 aa AA seqDB search
MSGARPLTVVVVDDSLTTRALIAAALRRDPRVKIVGTAGTPFEARDLIVRLNPDVLTLDF
EMPSMNGLQFLEKIMRLRPMPVVMVSGHLSSHRGLVEQSLRMGAAEWYSKTTTANGEDPF
AGLGDAIVRAAAMKQQAPVPVATDSANRTVPKIGTVVGIGASTGGVEALTDVLGHFPVAC
PPTVIVQHMPRQFSESFARRLDRIVKPEVRLAEEGDMLKPGTVYVASGGERHLRVRCGAR
SGEYVCQLVAAPPVNGHRPSVDELFYSLATTVGKNAVGVILTGMECDGAQGLLAMRHAGA
STIGQDRASSVIYGMPRAAYELGAVETQLPLSAIGPAILNLCERRSLETYP
NT seq 1056 nt NT seq  +upstreamnt  +downstreamnt
ttgagtggcgcaagacccctgactgtcgtggtcgtcgatgattccctgacgacccgcgcc
ctgatcgcggccgcacttcggcgggatcccagagtaaagatcgtggggactgccggaacg
ccctttgaagcgcgtgatcttatcgtgcggctgaatccggatgtgctgacgctcgatttc
gagatgccgtccatgaatggtctgcagtttcttgaaaagattatgaggttgcggccgatg
cccgtcgtgatggtgtcgggtcatctttccagtcaccggggactggttgagcagtcgctc
cggatgggagctgcggaatggtattcgaaaacgaccacggctaacggcgaggatccgttt
gcagggctgggagatgcgattgtccgggctgcggccatgaagcagcaggctcctgtgccg
gttgctacagattctgcaaacaggactgttccgaagataggcactgtcgtcgggattggg
gcatcgacagggggcgtggaagccttaacggatgttctggggcatttccccgtggcctgt
ccgccaacggttatcgtgcagcacatgccgcggcagttttcagaaagcttcgcacgtcgt
ctggaccggatcgtgaagccggaagtcaggcttgcggaagagggcgatatgctgaaaccc
ggcacggtgtatgtcgcgtctggtggagagcgccatctgcgcgtccgctgtggcgctcgg
tctggagaatatgtctgccagctggttgcggccccacccgttaacggacatcgcccttcg
gtggatgagctgttttattccctcgccaccacagtcgggaaaaatgctgtgggggtcatt
ctgacggggatggaatgtgacggggcgcagggtctgctggccatgcgtcatgccggcgcc
tccacaatcggtcaggaccgggcgagttccgtcatctatggcatgccccgagccgcatac
gaactgggcgctgtcgagacgcagcttccactttccgccattggcccagccattctcaat
ctttgtgaacgtcgctctctggagacatatccatga

DBGET integrated database retrieval system