KEGG   Gluconobacter oxydans 621H: GOX2065Help
Entry
GOX2065           CDS       T00230                                 

Definition
(GenBank) Siroheme synthase
  KO
K02302  uroporphyrin-III C-methyltransferase / precorrin-2 dehydrogenase / sirohydrochlorin ferrochelatase [EC:2.1.1.107 1.3.1.76 4.99.1.4]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00860  Porphyrin and chlorophyll metabolism
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:gox00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    GOX2065
Enzymes [BR:gox01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.76  precorrin-2 dehydrogenase
     GOX2065
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.107  uroporphyrinogen-III C-methyltransferase
     GOX2065
 4. Lyases
  4.99  Other lyases
   4.99.1  Sole sub-subclass for lyases that do not belong in the other subclasses
    4.99.1.4  sirohydrochlorin ferrochelatase
     GOX2065
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TP_methylase NAD_binding_7 CysG_dimeriser Sirohm_synth_M TetR_C_32
Motif
Other DBs
NCBI-ProteinID: AAW61801
UniProt: Q5FP95
Position
2262602..2264023
Genome map
AA seq 473 aa AA seqDB search
MNTQPHHSSPDSPQDGGWFPISIRLSGARVLLVGGGEIAVNKGRLLLDHGARIDVLAEKL
HPAVQGWVENGRVRHVGERADEAVLRRLLPGCRLVYAATDSRDTNRQVAALADELNIPVC
AVDDPGPSSFITPAQVRRGMVRVAVSTGGAAPVLARRLREQIETLLPEGTGRLATYMQSR
RAFVSGRYPNVQDRKRIWEDFLDGPGAEAARSGDESRADARLEVLLDGERKSGEVWLVGA
GPGDPDLLTLKALHLMQNADSVLYDNLVSPALLDMVRRDAELVFVGKQRDRHALPQDEIN
REMVRRAQGGERVLRLKGGDPFIFGRGGEEIEALVEAGVAFRLVPGISAANGCAAYSGIP
LTHRDCAQACLFVTGHAKADGVLDLPWDDMADRRQTVVIYMGISTLPQLAAGLLGKGLPA
DWPVAIVERGTQPRQRVFTGTLSTIAQQAAEAQVKSPALVIVGQVVRHRVVSP
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaacacccagcctcaccattccagcccggattcccctcaggacggcggctggtttcct
atttccatccgtctttcgggcgcgcgggtcctgctcgtgggcggcggagaaatcgccgtc
aacaagggacggctgctgctcgatcacggagcgcggatcgacgtcctggccgaaaaactg
cacccggccgtgcagggctgggtcgagaacggcagggtgcgccatgtgggcgaacgcgcg
gatgaggcggtgttgcgccgtctgcttccgggctgccggctggtctatgccgcgaccgac
agccgggacaccaaccgtcaggtcgcggctctcgctgacgaactgaatatccccgtctgc
gccgtggacgatcccggaccttccagtttcatcacgcccgctcaggtgcgtcggggcatg
gtgcgcgtggccgtctccaccggaggcgcggcccccgttctggcgcgccgcctgcgcgaa
cagatcgagacactgctgcccgaaggcacggggcgcctggcgacctatatgcagtcccgc
cgggcgttcgtctcggggcgctatcccaatgttcaggaccgcaaacgcatctgggaggat
tttctggatggtcccggcgcggaagccgcgcgctctggtgatgaaagccgggcggatgcg
cgactggaggtgctgctggacggggagcgcaagtcgggagaagtctggctggtgggggcg
ggtcccggtgatccggatctgctgaccctcaaggcgctgcacctgatgcagaatgcggat
tccgtactctatgacaatctggtctcgccagccctgctggacatggtgcgccgggacgcc
gaactcgtcttcgtcggcaagcagcgggatcgtcatgccctgccgcaggacgagatcaac
cgcgagatggtccgacgtgcacagggcggcgagcgcgtcctgcgtctcaagggcggggac
ccgttcatttttgggcgtggcggtgaggaaatcgaagctctggtcgaagccggtgttgcg
ttccggctggtgccgggcatttccgcggccaatggctgcgcagcctattccggcattccg
ctgacgcatcgggactgcgcgcaggcctgcctgttcgtgaccggacatgcaaaggcggac
ggcgttctggatctgccctgggacgacatggccgatcgccgccagacggtagtgatctat
atgggcatctcgaccctgccgcagcttgccgccggacttctgggaaaaggactgccggct
gactggccggtggcgatcgtggagcggggcacgcagccgcgacagcgggttttcaccggg
acgctgtctaccatcgcgcagcaggcggccgaagcgcaggtgaaatcgcccgcgctggtg
atcgtcgggcaggtcgtccggcaccgggtcgtttcgccctga

DBGET integrated database retrieval system