KEGG   Gluconobacter oxydans 621H: GOX2291Help
Entry
GOX2291           CDS       T00230                                 

Definition
(GenBank) Dihydrolipoamide acetyltransferase component of pyruvate dehydrogenase
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00010  Glycolysis / Gluconeogenesis
gox00020  Citrate cycle (TCA cycle)
gox00620  Pyruvate metabolism
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01200  Carbon metabolism
Module
gox_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX2291
   00020 Citrate cycle (TCA cycle)
    GOX2291
   00620 Pyruvate metabolism
    GOX2291
Enzymes [BR:gox01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     GOX2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 QRPTase_N
Motif
Other DBs
NCBI-ProteinID: AAW62024
UniProt: Q5FNM3
Position
2511361..2512572
Genome map
AA seq 403 aa AA seqDB search
MPALSPTMTEGKLARWLKAEGDTVSAGDVIAEIETDKATMEVEAVDEGILSRILIQEGVE
GIPVNTPIAVLVEDGEAVPEASSTQAPAAPKAEAAPAVLTGTAPAKAAPEEKGERIFVSP
LARRMARERGIALDALTGSGPNGRILKRDVEKGVTAPKTSPKAAPSAAPLAASEETVRHV
PNSTMRKVIARRLTESKTQVPHFYVSVDIELDALLDLRAKLNATAQENSFKISVNDMMIK
AVALALKKVPGVNVQFTDAETLHFENVDISMAVSVPDGLITPIIRNADRKSLRQISVEAK
DLAKRARAGKLKPEEFQGGTFSISNMGMFGVREFAAIINPPQAGILAIASGEKRAVVRGS
EIAVATVMTATLSVDHRAVDGALGAEWLNALRDIVQNPYTLVV
NT seq 1212 nt NT seq  +upstreamnt  +downstreamnt
atgccggcgctgtcgccgaccatgaccgagggcaaactggcccgctggctcaaagccgag
ggcgataccgtctccgctggcgacgtaattgccgagatcgaaaccgacaaggcgaccatg
gaagtggaagccgtggacgagggcatccttagccgcatcctgatccaggaaggcgtcgag
ggtattcccgtcaacacgccgatcgcggttcttgtggaagacggtgaggctgtgccggaa
gcctcttccacgcaggccccagcggccccgaaagcggaggccgctccggctgtattgacg
ggaacagcgcctgcaaaagcggcgccagaagagaagggcgagcggattttcgtctctccg
ctggcgcgccgcatggcacgtgaacggggcattgcccttgatgcgctgacgggaagcgga
ccgaacggccgtattctcaagcgcgatgtggaaaagggtgtgacggctccgaagacttcg
ccgaaagcagctccgtcagcggcacctcttgccgcttcggaagagacggtgcgtcacgtt
ccgaactccacgatgcgcaaggtcattgcgcggcgtctgacggagtccaagacgcaggtt
ccgcatttctatgtctcggttgatatcgagctggatgcgctgctggacctgcgtgcgaag
ctgaatgccaccgcgcaggaaaacagcttcaagatttccgtcaacgacatgatgatcaag
gccgttgcactggcgctgaagaaagtgccgggtgtaaacgtgcagttcacggatgccgag
acgctgcatttcgaaaatgtggacatctcgatggccgtgtcggtgccggacggtctgatc
acgccgatcatccgcaacgccgatcgcaagtccctgcgccagatcagcgtcgaagccaag
gatctggccaagcgcgcccgtgctggaaagctcaagcccgaggaattccagggcggcacg
ttctccatttccaacatgggcatgttcggcgtgcgcgagttcgcggcgatcatcaatccg
ccgcaggccggtatcctggcgattgcctcgggtgagaagagggccgtggtacgtggatca
gaaattgctgttgcaaccgtgatgacggcgacgctttcggtcgatcaccgtgccgtcgat
ggcgcgcttggtgccgaatggcttaatgcactgcgcgatatcgtgcagaacccttacact
ctggtggtctga

DBGET integrated database retrieval system