KEGG   Gluconobacter oxydans 621H: GOX2419Help
Entry
GOX2419           CDS       T00230                                 

Definition
(GenBank) Glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
gox  Gluconobacter oxydans 621H
Pathway
gox00010  Glycolysis / Gluconeogenesis
gox00052  Galactose metabolism
gox00500  Starch and sucrose metabolism
gox00520  Amino sugar and nucleotide sugar metabolism
gox00521  Streptomycin biosynthesis
gox01100  Metabolic pathways
gox01110  Biosynthesis of secondary metabolites
gox01120  Microbial metabolism in diverse environments
gox01130  Biosynthesis of antibiotics
gox01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:gox00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GOX2419
   00052 Galactose metabolism
    GOX2419
   00500 Starch and sucrose metabolism
    GOX2419
   00520 Amino sugar and nucleotide sugar metabolism
    GOX2419
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    GOX2419
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    GOX2419
Enzymes [BR:gox01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     GOX2419
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: AAW62150
UniProt: Q5FN97
Position
2630053..2631021
Genome map
AA seq 322 aa AA seqDB search
MREIVAVDIGGTHARFAIATIEDGKVVSLGEATTLKCAEHGSLALAWETFGRSLNRTLPR
EAGIAVACPVSGEILKLTNNPWIIQPSQLGARLHLDNFVLVNDFGAVAHAVAQVDSSHMK
HLCGPDIDLPTEGAITIVGPGTGLGAACLLRRSDRYFVMETEGGHLDYPPLDELEDKILS
ALRLRFRRVSAERIVSGPGLTNLYEVIAEMQGWPITLRDNRTLWKNALDGSDTVAVAALE
RFCLSLGAISGDLALAHGARGVVIGGGLGLRLADSLGHSGFAERFVAKGRFEAMMTEMPV
KIITHPQPGLFGAAAAYAEAHP
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgagggaaatcgtagccgtcgatatcggtggaacgcacgcacggtttgcaatcgcgacc
atcgaggatggcaaggtcgtctcactgggtgaggccacgacgctgaaatgcgcggaacat
ggcagtctggccttggcctgggaaacattcggccgttccctgaaccggacgcttccacgc
gaagccggcattgccgtagcctgtccggtaagcggcgagatcctcaagctgaccaacaat
ccttggatcatccagccgagccagctcggcgcgcgcctgcatctcgacaatttcgtactc
gtcaacgatttcggagccgtggctcacgccgtagcccaggtcgattcctcgcacatgaaa
catctctgcggaccggacatcgaccttccgacggaaggcgccatcacgatcgtcggcccg
ggcacaggactgggtgcagcctgcctgcttcgccgcagtgaccgctattttgtcatggaa
accgaaggcggccatctggactatccgccgctcgacgaactcgaagacaagatcctcagc
gccctgcgtctgcgttttcgccgcgtctctgccgagcggatcgtctccggaccgggcctg
accaatctgtacgaagtcattgccgagatgcagggctggcccatcaccctgcgtgataac
cgcaccttgtggaaaaacgccctcgatggctccgatacggtcgccgtggctgccctggaa
cgcttctgcctcagcctgggcgccatttccggcgatctggcgctggcacatggcgcacgc
ggcgtcgtcatcggtggtggtctgggactgcgtctcgccgacagcctcggccattccgga
ttcgccgaacgcttcgtcgcaaagggccgcttcgaggcgatgatgaccgaaatgccggtc
aagatcatcacacatccacagcccggcctgttcggcgctgcggcagcatacgcggaagcg
catccgtaa

DBGET integrated database retrieval system