KEGG   Gluconobacter oxydans DSM 3504: GLS_c03350Help
Entry
GLS_c03350        CDS       T03563                                 

Definition
(GenBank) zinc-dependent alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
goy  Gluconobacter oxydans DSM 3504
Pathway
goy00010  Glycolysis / Gluconeogenesis
goy00071  Fatty acid degradation
goy00350  Tyrosine metabolism
goy00625  Chloroalkane and chloroalkene degradation
goy00626  Naphthalene degradation
goy01100  Metabolic pathways
goy01110  Biosynthesis of secondary metabolites
goy01120  Microbial metabolism in diverse environments
goy01130  Biosynthesis of antibiotics
goy01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:goy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLS_c03350
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GLS_c03350
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    GLS_c03350
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    GLS_c03350
   00626 Naphthalene degradation
    GLS_c03350
Enzymes [BR:goy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     GLS_c03350
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N
Motif
Other DBs
NCBI-ProteinID: AHK70252
UniProt: A0A067Z2I4
Position
357954..358937
Genome map
AA seq 327 aa AA seqDB search
MFAMQLKAHHTPLEWVELPDPEPGPDEIRIRIGACGVCRTDLHVVDGELPHATLPIIPGH
EIVGRIDKLGSNVTGLSLGERVGVPWLGHTCGHCYYCTHGMENLCDHPLFTGFTRNGGYA
TMTVADARYAFPMGDKGEDKDLAPLLCAGLIGWRCLNKAGEGKKIGLYGFGAAAHIITQV
LRWQGREVYAFTSPGDTQKQDFARSLGAVWAGGSDELPPEPLDAVILFAPVGALLPAGLK
AIRKGGKVVCGGIHMSEIPAFSYDTLWEEREIVSVANLTRQDGLEFLKIAPEVGIKVTNT
PYALKDANQALDDLRHGRFDGAAVLLP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
atgttcgccatgcagctcaaagcccatcacacccctctggaatgggtcgaactccccgat
cccgaacccggccccgatgaaatccgcatccggatcggcgcctgcggcgtgtgccggaca
gacctgcatgtcgtggatggcgagctccctcatgccactcttcccatcatccccggccat
gaaatcgttggccggatcgacaagctcggcagcaatgtcacgggcctgtcgcttggcgag
agggtcggcgtgccctggctcggacatacctgcgggcactgctattactgcacgcacgga
atggaaaatctctgcgaccaccctctcttcacgggcttcacccgcaatggcggctacgcg
accatgacggtcgccgatgcccgctacgctttcccgatgggcgacaagggcgaggacaag
gatctcgcgcccctgctctgcgccggactgattggctggcgctgcctgaacaaggccggg
gagggcaagaagatcggcctctacggtttcggcgcggccgcccatatcatcacgcaggtc
ctgcgctggcagggccgcgaggtctacgccttcacatcccccggcgatacgcagaaacag
gatttcgcccgctccctcggcgccgtctgggctggtggctcggacgaactcccgcccgaa
ccactggacgccgtgatcctgtttgcccccgtcggcgccctgcttcctgcgggtctcaag
gccattcgcaagggtggtaaagtcgtgtgcggcggcatccacatgagcgaaatcccggcc
ttttcctacgacacattatgggaagagcgcgaaatcgtttccgtcgccaacctgacccgt
caggacggtctggaattcctgaaaatcgccccggaagtcggcatcaaggtcaccaacacg
ccctatgccctgaaggacgccaatcaggccctcgatgacctccggcacggccgtttcgac
ggtgccgccgtattgctgccctga

DBGET integrated database retrieval system