KEGG   Gluconobacter oxydans DSM 3504: GLS_c16680Help
Entry
GLS_c16680        CDS       T03563                                 

Gene name
fda
Definition
(GenBank) fructose-bisphosphate aldolase class 1
  KO
K01623  fructose-bisphosphate aldolase, class I [EC:4.1.2.13]
Organism
goy  Gluconobacter oxydans DSM 3504
Pathway
goy00010  Glycolysis / Gluconeogenesis
goy00030  Pentose phosphate pathway
goy00051  Fructose and mannose metabolism
goy00680  Methane metabolism
goy01100  Metabolic pathways
goy01110  Biosynthesis of secondary metabolites
goy01120  Microbial metabolism in diverse environments
goy01130  Biosynthesis of antibiotics
goy01200  Carbon metabolism
goy01230  Biosynthesis of amino acids
Module
goy_M00167  Reductive pentose phosphate cycle, glyceraldehyde-3P => ribulose-5P
Brite
KEGG Orthology (KO) [BR:goy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLS_c16680 (fda)
   00030 Pentose phosphate pathway
    GLS_c16680 (fda)
   00051 Fructose and mannose metabolism
    GLS_c16680 (fda)
  09102 Energy metabolism
   00680 Methane metabolism
    GLS_c16680 (fda)
Enzymes [BR:goy01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.13  fructose-bisphosphate aldolase
     GLS_c16680 (fda)
Membrane trafficking [BR:goy04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    GLS_c16680 (fda)
Chromosome and associated proteins [BR:goy03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Other centriole associated proteins
    GLS_c16680 (fda)
Exosome [BR:goy04147]
 Exosomal proteins
  Proteins found in most exosomes
   GLS_c16680 (fda)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glycolytic Guanylate_kin
Motif
Other DBs
NCBI-ProteinID: AHK71546
UniProt: A0A067Z3C1
Position
1913469..1914368
Genome map
AA seq 299 aa AA seqDB search
MSTAETMMSQMAEKGGFIAALDQSGGSTPGALKQYGIPESDYSGESEMFARMHEMRVRII
TAPSFTGDKVIGAILFERTMDGDVKGEPVPAYLWRERGVVPFVKIDKGLETEADGVQLMK
PMPGLDDLLERAVKLGIYGTKERSTIRLPSESGIRAIVQQQFAVAEQVRRHGLVPILEPE
VLIKSPDKKACEQLLHDYVLEELQKLPEDARIMLKVTIPEVPDLYDDIARDPRMVRVVAL
SGGYPLDQACEKLRHNHRMIASFSRALIGDLRHQMDDAQFDATLGRTIDEIYDASVNKV
NT seq 900 nt NT seq  +upstreamnt  +downstreamnt
atgagtaccgcggaaacgatgatgtctcagatggcggaaaaaggcggatttatcgctgct
ctggatcagagcggcggatccacgcctggtgcgctgaaacagtatggcatccctgaaagc
gattactcgggtgagagcgagatgtttgcgcgcatgcacgagatgcgggtgcggatcatc
acggcgccgtctttcacgggggacaaggtgatcggagccatcctgttcgagcgaacgatg
gatggagacgtgaaaggcgagccggtcccggcctatctctggcgcgagcggggtgtcgtt
ccgttcgtgaagatcgacaagggcctggaaacggaagcggacggcgtccagcttatgaag
ccgatgccggggctggatgacctgctggaacgggcagtgaagctgggtatttacggcacg
aaggagcgctccacgatccgcctgccgtccgagagcgggattcgcgctatcgtgcagcag
cagttcgcggtggcagaacaggttcgcaggcatgggctggtccccatcctggagccggaa
gtgctgatcaagagcccggacaagaaggcatgcgagcagcttttgcatgattatgttctg
gaggagcttcagaagcttcccgaagacgcgcggatcatgctgaaggtgacgatcccggaa
gtgcctgatctgtatgacgatatcgctcgtgatccgcgcatggtccgtgtcgttgcgctg
tcagggggctatccgctggatcaggcctgcgaaaagctgcgccataatcatcggatgatc
gcgagtttctcccgggccctgatcggggatctgcgccatcagatggatgatgcgcagttc
gatgcgacgctgggcaggacgatcgacgagatctacgacgcttcggtcaacaaggtctga

DBGET integrated database retrieval system