KEGG   Gluconobacter oxydans DSM 3504: GLS_c21270Help
Entry
GLS_c21270        CDS       T03563                                 

Gene name
gdh
Definition
(GenBank) glucose 1-dehydrogenase Gdh
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
goy  Gluconobacter oxydans DSM 3504
Pathway
goy00030  Pentose phosphate pathway
goy01100  Metabolic pathways
goy01120  Microbial metabolism in diverse environments
goy01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:goy00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    GLS_c21270 (gdh)
Enzymes [BR:goy01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     GLS_c21270 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase THF_DHG_CYH_C Eno-Rase_NADH_b
Motif
Other DBs
NCBI-ProteinID: AHK71998
UniProt: A0A067Z679
Position
complement(2428736..2429536)
Genome map
AA seq 266 aa AA seqDB search
MPAPYKDRFAGKKVLVTGASQGIGEATALRFAEEGAQVALNGRKEDKLIAVREKLPKVSG
GEHPIATGDISKEDDVKRLVAESIKAMGGLDVLVCNAGYQIPSPSEDIKLKDFEGVMAVN
VTGVMLPCREVIRYWLENGIKGTIIVNSSVHQIIPKPHYLGYSASKGAVGNIVRTLALEY
ASRGIRVNAVAPGAIVTPINMSWIDDPEQYKAVSSHIPMKRPGESREIADAITFLAAEDS
TYITGQTLYVDGGLTLYGDFENNWSS
NT seq 801 nt NT seq  +upstreamnt  +downstreamnt
atgcctgccccttacaaagaccgtttcgccggcaagaaagtcctcgtcaccggggcatcc
cagggaattggcgaggccaccgcgcttcgttttgccgaagaaggcgcgcaggtcgccctc
aacggccgcaaggaagacaagctgatcgccgttcgcgagaagctgcccaaggtttccggc
ggagagcacccgatcgccacgggtgacatttccaaagaagacgacgtcaaacgtctggtt
gccgagagcatcaaggccatgggcggtctcgacgttctggtctgcaatgcgggctatcag
atcccctctccctccgaagacatcaagctcaaagattttgaaggcgtgatggccgtcaac
gtcacgggggtgatgctgccctgtcgcgaagtcatccgctactggctggaaaacggcatc
aagggcacgatcatcgtgaactcctccgtccaccagatcatccccaagccgcattatctg
ggctattccgcgtccaagggtgctgtcggtaatatcgtccgcacgctggcgctggaatat
gccagccgcggcatccgcgtgaacgccgtggcgcccggcgccatcgtgacgccgatcaac
atgtcgtggatcgatgatcccgaacagtacaaggccgtttcaagccacatcccgatgaag
cgcccgggcgaaagccgcgaaatcgcggatgccatcaccttcctcgccgccgaggacagc
acctacatcacgggtcagaccctgtatgtcgatggtggtctgacgctctacggcgatttc
gaaaacaactggtcctcgtaa

DBGET integrated database retrieval system