KEGG   Gordonibacter pamelaeae: GPA_07910Help
Entry
GPA_07910         CDS       T02609                                 

Definition
(GenBank) acetyl-CoA carboxylase, biotin carboxyl carrier protein
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
gpa  Gordonibacter pamelaeae
Pathway
gpa00620  Pyruvate metabolism
gpa01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gpa00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    GPA_07910
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:gpa02000]
    GPA_07910
Enzymes [BR:gpa01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     GPA_07910
Transporters [BR:gpa02000]
 Other transporters
  Primary active transporters [TC:3]
   GPA_07910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl
Motif
Other DBs
NCBI-ProteinID: CBL03616
UniProt: D6E7B9
Position
complement(763142..765016)
Genome map
AA seq 624 aa AA seqDB search
MDTTIRDGQQSLWATRMQIGDMLPILPKMDRVGYWAIEAWGGATFDTCLRFLDENPWERL
RSIKANTPNTPLAMLSRGQNLVGYKHYSREICNRFIKASKRNGIHVFRVFDALNDIRNVV
DNAEAIKECGGHFEGAISYTMSPVHTLDSYLEYGQKMKDLGADSIAIKDMAGMLTPYRTE
RMVKAFNAEIGLPLHIHCHYVGGMAPANIIKAAEAGAAIADTAHAPLAFGNSHPAVEMIV
AALQESRYDTGLNLDLLFEIAEYWEEVRKRGHYKRGVSSLTHMKVYSHQVPGGMMSNLVS
QLEIQNAGDRLPEVMQEIPKVRAEVGYPPLVTPLSQIVGTQAVFNVLTGKRWSVVSKEMK
DYICGYYGKAPGRMDKDIVAKVVGNSEMLPPDVAPGSLVTTTYSQVEDEIGDLAKSEEDV
LMYALFPNEARTYLSKHRTSEKVDFLMEQESSHTKEDDYVDINQIRELVRVAEESGVGEI
VVEEEGTRIAVRMPGTLSSDAVAAAAATASVAAVAPAPAAEASASAGDGIERPSNWYCVT
APMVGTFYTSPAPGEPPFVQVGDEVAANQTLCIVEAMKLMNEITAEEMGTVREVCLEDAS
PVEFGTPLFYVEPHGAPAPAPETA
NT seq 1875 nt NT seq  +upstreamnt  +downstreamnt
atggataccacgatccgcgacggccagcagagcctctgggccacgcgcatgcagatcggg
gacatgctgccgatcctgccgaagatggaccgggtcgggtactgggctatcgaggcttgg
ggcggcgcgacgttcgacacgtgcctgcgctttctcgacgagaacccgtgggagcgtctg
cgatctatcaaggcgaacacgccgaacacgccgctcgccatgctgtcccgcggtcagaac
ctcgtggggtacaagcattactcgcgcgagatctgcaaccgtttcatcaaggcttccaag
cgcaacggcatccacgtgttccgcgtgttcgacgccctcaacgatatccgcaacgtcgtg
gacaacgccgaggccatcaaggaatgcggcggccacttcgagggcgccatctcctacacc
atgtcgcccgtccacacgcttgacagctacctggagtacggccagaagatgaaggatctg
ggcgccgactccatcgccatcaaggacatggccggcatgctcacgccctaccgcaccgag
cgcatggtgaaggcgttcaacgccgagatcggcctgccgctgcacatccactgccattac
gtgggcggcatggcgcccgccaacatcatcaaggccgccgaggccggcgccgccatcgcg
gacacggcccacgcgccgctcgccttcggcaactcgcaccctgcggtggagatgatcgtg
gccgccctccaggagagccgctacgacacgggcctgaacctggacctgctgttcgagatc
gccgagtactgggaggaggtgcgcaagcgcggccactacaagcgcggcgtgtcctcgctc
acgcacatgaaggtgtactcgcaccaggtgcccggcggcatgatgtcgaacctggtgtcg
cagctggagatccagaacgccggcgaccgcctgcccgaggtcatgcaggagatcccgaag
gtgcgcgccgaggtgggctacccgccgctcgtcacgcccctgtcgcagatcgtgggcacg
caggccgtgttcaacgtgctcaccggcaagcgctggagcgtcgtgtccaaggagatgaag
gactacatctgcggctactacggcaaggcgccgggccgcatggacaaggacatcgtggcc
aaggtcgtgggcaactccgagatgctgccgcccgacgtggcccccggctcgctcgtgacc
accacgtactcccaggtggaggacgagatcggcgacctcgcgaagagcgaggaggacgtg
ctcatgtacgccctgttcccgaacgaggcgcgcacgtacctgagcaagcaccgcacatcg
gagaaggtcgacttcctcatggagcaggagtcgagccataccaaggaggacgattacgtg
gacatcaatcagattcgcgagctggttcgcgtcgccgaggagagcggcgtcggcgagatc
gtagtcgaggaggagggcacgcgcatcgccgtgcgcatgccgggcacgctgtcctccgac
gccgtggcggctgcagccgccacggcgtcggtggccgccgtcgcccccgctcctgcggcc
gaggcttccgcttccgccggcgacggtatcgagcgcccctccaactggtactgcgtgacg
gctcccatggtgggcacgttctacacgtcccccgcgcccggcgagccgccgttcgtgcag
gtgggcgacgaggtcgctgccaaccagacgctctgcatcgtggaggccatgaagctcatg
aacgagatcacggccgaggagatgggcacggtgcgcgaggtgtgcctcgaggatgcctcg
cccgtggagttcggcacgccgctgttctacgtcgagccccacggcgccccggccccggcc
ccggagacggcgtaa

DBGET integrated database retrieval system