KEGG   Gordonibacter pamelaeae: GPA_11030Help
Entry
GPA_11030         CDS       T02609                                 

Definition
(GenBank) homoserine O-succinyltransferase
  KO
K00651  homoserine O-succinyltransferase/O-acetyltransferase [EC:2.3.1.46 2.3.1.31]
Organism
gpa  Gordonibacter pamelaeae
Pathway
gpa00270  Cysteine and methionine metabolism
gpa00920  Sulfur metabolism
gpa01100  Metabolic pathways
gpa01110  Biosynthesis of secondary metabolites
gpa01130  Biosynthesis of antibiotics
gpa01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:gpa00001]
 09100 Metabolism
  09102 Energy metabolism
   00920 Sulfur metabolism
    GPA_11030
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    GPA_11030
Enzymes [BR:gpa01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.31  homoserine O-acetyltransferase
     GPA_11030
    2.3.1.46  homoserine O-succinyltransferase
     GPA_11030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HTS
Motif
Other DBs
NCBI-ProteinID: CBL03809
UniProt: D6E7W2
Position
1082573..1083514
Genome map
AA seq 313 aa AA seqDB search
MPIKIPDALPATDVLEGENIFVMTEFRAMHQDIRPLKVLLLNLMPTKIVTETQIMRKLSN
TPLQIEVSLLQTASHESKNVSEQHLETFYTTFDEIKGQHFDGMIITGAPVELLDFEDVDY
WDELAKIMAWSATNVHSTLHICWGAQAGIYYHYGIPKYELPEKLFGVFEHEVVKPSSPLV
RGFNDFFRAPHSRYTEVHASDIEAHPDLELIAVSDEAGVYLAKSTDSRHFFVFGHPEYDA
GTLMVEYERDIAKGLDMPLPRHYFPGDDPAQEPRATWRAHAQLLYTNWLNYYVYQTTPYD
LAKVGTEEDDDRG
NT seq 942 nt NT seq  +upstreamnt  +downstreamnt
atgcctatcaaaatacccgacgcgttgcccgcgaccgacgtcctcgaaggcgagaacatc
ttcgtgatgaccgagttccgcgccatgcaccaggacatccgtcccctgaaagtgctgctg
ctcaacctcatgcccacgaagatcgtcaccgagacgcagatcatgcgcaagctgtccaac
acgccgctccagatagaggtgagcctgctgcaaacggccagccatgagtccaaaaacgtg
tccgagcagcatttggaaacgttctacaccacgttcgacgagatcaaaggccagcacttc
gatggcatgatcatcaccggcgcgcccgtggagctgctggacttcgaggacgtggactac
tgggacgagcttgcgaagatcatggcgtggtccgctacgaatgtgcactccacgctgcat
atctgctggggtgcgcaggctggcatctactaccactacggcattcccaagtacgagctg
ccggagaagctgttcggagtgttcgagcacgaggtggtgaagccgtcttcgccgctcgtg
cgcggcttcaacgacttcttcagagcgccccattcgcgttacaccgaggttcatgcgtcc
gatatcgaggcgcatcccgacctggagcttattgccgtgtccgacgaggcaggcgtctac
ctggccaagagcaccgacagccgtcacttcttcgtgttcgggcatccggagtacgatgcc
ggaacgctcatggtggagtacgagcgcgacatcgcgaagggcctggacatgcccctgccg
cgccactatttcccgggcgacgatcctgcgcaggagccccgcgccacctggcgcgcccac
gcgcagctgctctacacgaactggttgaactactacgtgtaccagaccacgccgtacgac
ctggcaaaagtgggaaccgaggaggacgacgaccgtggctga

DBGET integrated database retrieval system