KEGG   Gamma proteobacterium HdN1: HDN1F_01620Help
Entry
HDN1F_01620       CDS       T01300                                 

Gene name
gmk
Definition
(GenBank) Guanylate kinase (GMP kinase)
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00230  Purine metabolism
gpb01100  Metabolic pathways
Module
gpb_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:gpb00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    HDN1F_01620 (gmk)
Enzymes [BR:gpb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     HDN1F_01620 (gmk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 TsaE RsgA_GTPase Peptidase_M75 MMR_HSR1 AAA_22 CPT AAA ABC_tran AAA_18 NTPase_1
Motif
Other DBs
NCBI-ProteinID: CBL43745
UniProt: E1VG03
Position
complement(214132..214746)
Genome map
AA seq 204 aa AA seqDB search
MSGTLFVLSAPSGAGKTSLVKSILEALPNLVTSVSHTTRPQRQGEQDGINYHFVDQERFT
AMLDQNDFLEHAEVFGNFYGTSRSFVAETLAHGQDVILEIDWQGAQQIRHLFPESISIFI
LPPSRNALDARLHGRGQDSEATIQTRLAKARDEMSHYVEYDYLIINDDFDTALQELCAII
RASRLKILGQMRRHERLLQNLLNP
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgtctggcaccctgtttgtgctttccgcgccctctggcgctggcaaaaccagtctggtc
aagtcgatactggaagcgctaccaaaccttgttacctccgtgtctcacaccacccgcccc
cagcggcaaggggagcaagatggcatcaactaccattttgtcgaccaagagcgcttcacg
gcaatgctcgaccaaaatgattttttagaacatgccgaggtgttcggcaacttttatggc
accagtcgcagctttgttgctgagacactcgctcacggccaagacgtgattttagaaatc
gactggcagggcgcacagcaaattcggcatttattcccagaatccatcagcatttttatc
ctgcccccctcccgcaacgcgctggatgcacgcctgcatgggcgcggccaagatagcgag
gccactatccaaacccgactcgccaaggcgcgcgacgaaatgtcgcactacgtcgagtac
gactacctgattattaacgacgatttcgacaccgccttacaggaactttgcgccatcatc
cgtgcatctcgcctcaagatcctagggcaaatgcggcgtcacgaacgtctgctgcaaaac
ttgctaaacccctaa

DBGET integrated database retrieval system