KEGG   Gamma proteobacterium HdN1: HDN1F_09000Help
Entry
HDN1F_09000       CDS       T01300                                 

Definition
(GenBank) Putative acyl-CoA thiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
gpb  Gamma proteobacterium HdN1
Pathway
gpb00071  Fatty acid degradation
gpb00072  Synthesis and degradation of ketone bodies
gpb00280  Valine, leucine and isoleucine degradation
gpb00310  Lysine degradation
gpb00362  Benzoate degradation
gpb00380  Tryptophan metabolism
gpb00620  Pyruvate metabolism
gpb00630  Glyoxylate and dicarboxylate metabolism
gpb00640  Propanoate metabolism
gpb00650  Butanoate metabolism
gpb00900  Terpenoid backbone biosynthesis
gpb01100  Metabolic pathways
gpb01110  Biosynthesis of secondary metabolites
gpb01120  Microbial metabolism in diverse environments
gpb01130  Biosynthesis of antibiotics
gpb01200  Carbon metabolism
gpb01212  Fatty acid metabolism
gpb02020  Two-component system
Brite
KEGG Orthology (KO) [BR:gpb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    HDN1F_09000
   00630 Glyoxylate and dicarboxylate metabolism
    HDN1F_09000
   00640 Propanoate metabolism
    HDN1F_09000
   00650 Butanoate metabolism
    HDN1F_09000
  09103 Lipid metabolism
   00071 Fatty acid degradation
    HDN1F_09000
   00072 Synthesis and degradation of ketone bodies
    HDN1F_09000
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    HDN1F_09000
   00310 Lysine degradation
    HDN1F_09000
   00380 Tryptophan metabolism
    HDN1F_09000
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    HDN1F_09000
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    HDN1F_09000
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    HDN1F_09000
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gpb04147]
    HDN1F_09000
Enzymes [BR:gpb01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     HDN1F_09000
Exosome [BR:gpb04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   HDN1F_09000
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: CBL44483
UniProt: E1VI41
Position
complement(1109731..1110912)
Genome map
AA seq 393 aa AA seqDB search
MSNDPIVILNGARTPMGGFQGSLSSVTATQLGAIAIREAIQRAGLTPDDIQEVIMGCVLP
AGLKQGPARQAALDAGIPASAGATTINKLCGSGMKATMLAHDLIKVGTNDIMVAGGMESM
SNAPYVLEKARSGYRMGHGEIKDHMFLDGLEDAKTGRLMGSFAQDTADKHGISREAMDAF
AIESLRRAQKAVSDGSFTAEIVPVTVKTRKGEETVSIDEQPGNAKPEKIPTLKPAFRKDG
TITAANSSSISDGASALVLTRESIAKARNLKPVARIIAHATQSQHPSEFTEAPVGSVTRV
LEKAGWKAEDVDLWEINEAFAIVSMIAMQKHNIPHDRVNVHGGACALGHPIGSTGSRIVL
SLIHALQKYGKKRGVASLCIGGGEATSIALELI
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaatgaccctattgttatcctgaacggcgcacgcacccccatgggcggcttccaa
ggctccctctcctctgttactgccacccaactcggtgccatcgcaatccgcgaagcgatt
cagcgtgcaggccttacgcctgacgacattcaagaagtaatcatgggctgcgtgctcccc
gctggcctcaaacaaggccccgcacggcaggcagcactggacgccggcatcccagccagc
gccggagccaccacgattaacaaactatgcggctccggcatgaaagccaccatgttagcg
cacgatctcatcaaggtcggcaccaatgacatcatggtcgcgggcgggatggagagcatg
agcaacgcaccctatgtactcgaaaaggcacgcagcggctaccgcatgggccacggtgaa
atcaaagatcacatgtttctagacggccttgaagacgccaaaactggccgactaatgggt
tctttcgcacaagacaccgccgataaacacggaatcagccgcgaagcgatggacgcattc
gccatcgaatcgctgcgccgcgctcagaaagcggtgagcgatggaagctttaccgccgaa
atcgtcccagtcaccgtaaaaacccgcaaaggcgaagaaaccgtctccattgacgaacaa
cctggcaacgccaaaccggaaaaaatccctaccctcaaacctgccttcaggaaagacggc
accatcaccgccgccaactccagctccatctccgacggcgcgtccgccctcgtgctcacc
cgtgaaagcattgcaaaagcacgcaacctcaagcccgtagcccgcatcatcgcgcacgct
acccaatcacagcacccatccgaattcacggaagcccccgtaggctccgtcacccgcgtc
ctcgaaaaagcaggctggaaagcggaagacgtcgatctctgggaaatcaacgaagccttc
gcaatcgtctccatgatcgccatgcagaagcacaacatcccccacgatcgcgtcaacgtc
cacggcggcgcctgcgccctcggccatcccatcggctcaaccggctcacgcatcgttctt
agcctaatacacgcactgcaaaaatacggcaagaaacgcggcgtagcctccctctgcatc
ggcggcggcgaagccacttccatcgcactcgaactcatctaa

DBGET integrated database retrieval system